Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8R1W2

- GSG1_MOUSE

UniProt

Q8R1W2 - GSG1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Germ cell-specific gene 1 protein

Gene

Gsg1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

May cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.1 Publication

GO - Molecular functioni

  1. RNA polymerase binding Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Germ cell-specific gene 1 protein
Alternative name(s):
Germ cell-associated protein 1
Gene namesi
Name:Gsg1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 6

Organism-specific databases

MGIiMGI:1194499. Gsg1.

Subcellular locationi

Endoplasmic reticulum membrane 1 Publication; Multi-pass membrane protein 1 Publication
Note: Colocalizes with PAPOLB in the endoplasmic reticulum.

GO - Cellular componenti

  1. endoplasmic reticulum Source: MGI
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 324324Germ cell-specific gene 1 proteinPRO_0000329462Add
BLAST

Proteomic databases

PRIDEiQ8R1W2.

PTM databases

PhosphoSiteiQ8R1W2.

Expressioni

Tissue specificityi

Expressed in spermatogenic cells (at protein level). Expressed in germ cells within the testis from day 21 onwards.2 Publications

Gene expression databases

BgeeiQ8R1W2.
ExpressionAtlasiQ8R1W2. baseline.
GenevestigatoriQ8R1W2.

Interactioni

Subunit structurei

Interacts with PAPOLB.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
PapolbQ9WVP68EBI-7842142,EBI-7842113

Protein-protein interaction databases

BioGridi200083. 1 interaction.
IntActiQ8R1W2. 3 interactions.
MINTiMINT-6167922.

Structurei

3D structure databases

ProteinModelPortaliQ8R1W2.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei15 – 3521HelicalSequence AnalysisAdd
BLAST
Transmembranei127 – 14721HelicalSequence AnalysisAdd
BLAST
Transmembranei164 – 18421HelicalSequence AnalysisAdd
BLAST
Transmembranei208 – 22821HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the GSG1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG47621.
GeneTreeiENSGT00390000011933.
HOGENOMiHOG000112826.
HOVERGENiHBG069545.
InParanoidiQ8R1W2.
OMAiWNYGWAF.
OrthoDBiEOG715Q4M.
PhylomeDBiQ8R1W2.
TreeFamiTF331388.

Family and domain databases

InterProiIPR012478. GSG-1.
[Graphical view]
PfamiPF07803. GSG-1. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8R1W2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKMEFQKGS SDQRTFISAI LNMLSLGLST ASLLSSEWFV GTQKVPKPLC
60 70 80 90 100
GQSLAAKCFD MPMSLDGGIA NTSAQEVVQY TWETGDDRFS FLAFRSGMWL
110 120 130 140 150
SCEETMEEPG EKCRRFIELT PPAQRWLSLG AQTAYIGLQL ISFLLLLTDL
160 170 180 190 200
LLTTNPGCGL KLSAFAAVSL VLSGLLGMVA HMLYSQVFQA TANLGPEDWR
210 220 230 240 250
PHSWNYGWAF YTAWVSFTCC MASAVTTFNM YTRMVLEFKC RHSKSFNTNP
260 270 280 290 300
SCLAQHHRCF LPPPLTCTTH AGEPLSSCHQ YPSHPIRSVS EAIDLYSALQ
310 320
DKEFQQGISQ ELKEVVEPSV EEQR
Length:324
Mass (Da):36,108
Last modified:April 29, 2008 - v2
Checksum:i9AB3A42C147F2B90
GO
Isoform 2 (identifier: Q8R1W2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-125: R → RGEKGLLEFATLQGSCHPTLRFGGEWLMEKASLLHLPWGPVAKVF

Show »
Length:368
Mass (Da):40,943
Checksum:i0ADF2ADD7DC5E4C3
GO
Isoform 3 (identifier: Q8R1W2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-107: Missing.
     108-125: EPGEKCRRFIELTPPAQR → MEKASLLHLPWGPVAKVF

Show »
Length:217
Mass (Da):24,215
Checksum:iC9775ACA6478AF1B
GO
Isoform 4 (identifier: Q8R1W2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MAKM → M
     125-125: R → RGEKGLLEFATLQGSCHPTLRFGGEWLMEKASLLHLPWGPVAKVF

Show »
Length:365
Mass (Da):40,613
Checksum:i2D0A0AEC0EA971FD
GO

Sequence cautioni

The sequence BAA37087.1 differs from that shown. Reason: Frameshift at several positions.
The sequence AAH23009.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti178 – 1781M → I in BAC40258. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 107107Missing in isoform 3. 1 PublicationVSP_032999Add
BLAST
Alternative sequencei1 – 44MAKM → M in isoform 4. 2 PublicationsVSP_032998
Alternative sequencei108 – 12518EPGEK…PPAQR → MEKASLLHLPWGPVAKVF in isoform 3. 1 PublicationVSP_033000Add
BLAST
Alternative sequencei125 – 1251R → RGEKGLLEFATLQGSCHPTL RFGGEWLMEKASLLHLPWGP VAKVF in isoform 2 and isoform 4. 3 PublicationsVSP_033001

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D87325 mRNA. Translation: BAA37087.1. Frameshift.
AK006326 mRNA. Translation: BAB24527.1.
AK088285 mRNA. Translation: BAC40258.1.
AC122820 Genomic DNA. No translation available.
BC023009 mRNA. Translation: AAH23009.1. Different initiation.
CCDSiCCDS39682.1. [Q8R1W2-2]
CCDS39683.1. [Q8R1W2-4]
RefSeqiNP_001074021.1. NM_001080552.1. [Q8R1W2-2]
NP_001074022.1. NM_001080553.1. [Q8R1W2-4]
NP_034482.2. NM_010352.2. [Q8R1W2-4]
UniGeneiMm.272306.

Genome annotation databases

EnsembliENSMUST00000087729; ENSMUSP00000085022; ENSMUSG00000030206. [Q8R1W2-2]
ENSMUST00000111910; ENSMUSP00000107541; ENSMUSG00000030206. [Q8R1W2-4]
ENSMUST00000111911; ENSMUSP00000107542; ENSMUSG00000030206. [Q8R1W2-4]
GeneIDi14840.
KEGGimmu:14840.
UCSCiuc009elj.1. mouse. [Q8R1W2-2]
uc009elk.1. mouse. [Q8R1W2-4]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
D87325 mRNA. Translation: BAA37087.1 . Frameshift.
AK006326 mRNA. Translation: BAB24527.1 .
AK088285 mRNA. Translation: BAC40258.1 .
AC122820 Genomic DNA. No translation available.
BC023009 mRNA. Translation: AAH23009.1 . Different initiation.
CCDSi CCDS39682.1. [Q8R1W2-2 ]
CCDS39683.1. [Q8R1W2-4 ]
RefSeqi NP_001074021.1. NM_001080552.1. [Q8R1W2-2 ]
NP_001074022.1. NM_001080553.1. [Q8R1W2-4 ]
NP_034482.2. NM_010352.2. [Q8R1W2-4 ]
UniGenei Mm.272306.

3D structure databases

ProteinModelPortali Q8R1W2.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 200083. 1 interaction.
IntActi Q8R1W2. 3 interactions.
MINTi MINT-6167922.

PTM databases

PhosphoSitei Q8R1W2.

Proteomic databases

PRIDEi Q8R1W2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000087729 ; ENSMUSP00000085022 ; ENSMUSG00000030206 . [Q8R1W2-2 ]
ENSMUST00000111910 ; ENSMUSP00000107541 ; ENSMUSG00000030206 . [Q8R1W2-4 ]
ENSMUST00000111911 ; ENSMUSP00000107542 ; ENSMUSG00000030206 . [Q8R1W2-4 ]
GeneIDi 14840.
KEGGi mmu:14840.
UCSCi uc009elj.1. mouse. [Q8R1W2-2 ]
uc009elk.1. mouse. [Q8R1W2-4 ]

Organism-specific databases

CTDi 83445.
MGIi MGI:1194499. Gsg1.

Phylogenomic databases

eggNOGi NOG47621.
GeneTreei ENSGT00390000011933.
HOGENOMi HOG000112826.
HOVERGENi HBG069545.
InParanoidi Q8R1W2.
OMAi WNYGWAF.
OrthoDBi EOG715Q4M.
PhylomeDBi Q8R1W2.
TreeFami TF331388.

Miscellaneous databases

NextBioi 287055.
PROi Q8R1W2.
SOURCEi Search...

Gene expression databases

Bgeei Q8R1W2.
ExpressionAtlasi Q8R1W2. baseline.
Genevestigatori Q8R1W2.

Family and domain databases

InterProi IPR012478. GSG-1.
[Graphical view ]
Pfami PF07803. GSG-1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation and characterization of cDNA clones specifically expressed in testicular germ cells."
    Tanaka H., Yoshimura Y., Nishina Y., Nozaki M., Nojima H., Nishimune Y.
    FEBS Lett. 355:4-10(1994) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY.
    Strain: C57BL/6.
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Strain: C57BL/6.
    Tissue: Testis.
  3. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Strain: C57BL/6J and NOD.
    Tissue: Testis and Thymus.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Eye.
  6. "Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions."
    Choi H.-S., Lee S.-H., Kim H., Lee Y.
    FEBS Lett. 582:1203-1209(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH PAPOLB, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiGSG1_MOUSE
AccessioniPrimary (citable) accession number: Q8R1W2
Secondary accession number(s): Q8C2N5, Q9D9Z3, Q9Z1H7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 29, 2008
Last sequence update: April 29, 2008
Last modified: October 29, 2014
This is version 73 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3