Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8R1W2

- GSG1_MOUSE

UniProt

Q8R1W2 - GSG1_MOUSE

Protein

Germ cell-specific gene 1 protein

Gene

Gsg1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 72 (01 Oct 2014)
      Sequence version 2 (29 Apr 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum.1 Publication

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. RNA polymerase binding Source: MGI

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Germ cell-specific gene 1 protein
    Alternative name(s):
    Germ cell-associated protein 1
    Gene namesi
    Name:Gsg1
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 6

    Organism-specific databases

    MGIiMGI:1194499. Gsg1.

    Subcellular locationi

    Endoplasmic reticulum membrane 1 Publication; Multi-pass membrane protein 1 Publication
    Note: Colocalizes with PAPOLB in the endoplasmic reticulum.

    GO - Cellular componenti

    1. endoplasmic reticulum Source: MGI
    2. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    3. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 324324Germ cell-specific gene 1 proteinPRO_0000329462Add
    BLAST

    Proteomic databases

    PRIDEiQ8R1W2.

    PTM databases

    PhosphoSiteiQ8R1W2.

    Expressioni

    Tissue specificityi

    Expressed in spermatogenic cells (at protein level). Expressed in germ cells within the testis from day 21 onwards.2 Publications

    Gene expression databases

    BgeeiQ8R1W2.
    GenevestigatoriQ8R1W2.

    Interactioni

    Subunit structurei

    Interacts with PAPOLB.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    PapolbQ9WVP68EBI-7842142,EBI-7842113

    Protein-protein interaction databases

    BioGridi200083. 1 interaction.
    IntActiQ8R1W2. 3 interactions.
    MINTiMINT-6167922.

    Structurei

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei15 – 3521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei127 – 14721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei164 – 18421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei208 – 22821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the GSG1 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG47621.
    GeneTreeiENSGT00390000011933.
    HOGENOMiHOG000112826.
    HOVERGENiHBG069545.
    OMAiWNYGWAF.
    OrthoDBiEOG715Q4M.
    PhylomeDBiQ8R1W2.
    TreeFamiTF331388.

    Family and domain databases

    InterProiIPR012478. GSG-1.
    [Graphical view]
    PfamiPF07803. GSG-1. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8R1W2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAKMEFQKGS SDQRTFISAI LNMLSLGLST ASLLSSEWFV GTQKVPKPLC    50
    GQSLAAKCFD MPMSLDGGIA NTSAQEVVQY TWETGDDRFS FLAFRSGMWL 100
    SCEETMEEPG EKCRRFIELT PPAQRWLSLG AQTAYIGLQL ISFLLLLTDL 150
    LLTTNPGCGL KLSAFAAVSL VLSGLLGMVA HMLYSQVFQA TANLGPEDWR 200
    PHSWNYGWAF YTAWVSFTCC MASAVTTFNM YTRMVLEFKC RHSKSFNTNP 250
    SCLAQHHRCF LPPPLTCTTH AGEPLSSCHQ YPSHPIRSVS EAIDLYSALQ 300
    DKEFQQGISQ ELKEVVEPSV EEQR 324
    Length:324
    Mass (Da):36,108
    Last modified:April 29, 2008 - v2
    Checksum:i9AB3A42C147F2B90
    GO
    Isoform 2 (identifier: Q8R1W2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         125-125: R → RGEKGLLEFATLQGSCHPTLRFGGEWLMEKASLLHLPWGPVAKVF

    Show »
    Length:368
    Mass (Da):40,943
    Checksum:i0ADF2ADD7DC5E4C3
    GO
    Isoform 3 (identifier: Q8R1W2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-107: Missing.
         108-125: EPGEKCRRFIELTPPAQR → MEKASLLHLPWGPVAKVF

    Show »
    Length:217
    Mass (Da):24,215
    Checksum:iC9775ACA6478AF1B
    GO
    Isoform 4 (identifier: Q8R1W2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-4: MAKM → M
         125-125: R → RGEKGLLEFATLQGSCHPTLRFGGEWLMEKASLLHLPWGPVAKVF

    Show »
    Length:365
    Mass (Da):40,613
    Checksum:i2D0A0AEC0EA971FD
    GO

    Sequence cautioni

    The sequence BAA37087.1 differs from that shown. Reason: Frameshift at several positions.
    The sequence AAH23009.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti178 – 1781M → I in BAC40258. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 107107Missing in isoform 3. 1 PublicationVSP_032999Add
    BLAST
    Alternative sequencei1 – 44MAKM → M in isoform 4. 2 PublicationsVSP_032998
    Alternative sequencei108 – 12518EPGEK…PPAQR → MEKASLLHLPWGPVAKVF in isoform 3. 1 PublicationVSP_033000Add
    BLAST
    Alternative sequencei125 – 1251R → RGEKGLLEFATLQGSCHPTL RFGGEWLMEKASLLHLPWGP VAKVF in isoform 2 and isoform 4. 3 PublicationsVSP_033001

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D87325 mRNA. Translation: BAA37087.1. Frameshift.
    AK006326 mRNA. Translation: BAB24527.1.
    AK088285 mRNA. Translation: BAC40258.1.
    AC122820 Genomic DNA. No translation available.
    BC023009 mRNA. Translation: AAH23009.1. Different initiation.
    CCDSiCCDS39682.1. [Q8R1W2-2]
    CCDS39683.1. [Q8R1W2-4]
    RefSeqiNP_001074021.1. NM_001080552.1. [Q8R1W2-2]
    NP_001074022.1. NM_001080553.1. [Q8R1W2-4]
    NP_034482.2. NM_010352.2. [Q8R1W2-4]
    UniGeneiMm.272306.

    Genome annotation databases

    EnsembliENSMUST00000087729; ENSMUSP00000085022; ENSMUSG00000030206. [Q8R1W2-2]
    ENSMUST00000111910; ENSMUSP00000107541; ENSMUSG00000030206. [Q8R1W2-4]
    ENSMUST00000111911; ENSMUSP00000107542; ENSMUSG00000030206. [Q8R1W2-4]
    GeneIDi14840.
    KEGGimmu:14840.
    UCSCiuc009elj.1. mouse. [Q8R1W2-2]
    uc009elk.1. mouse. [Q8R1W2-4]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    D87325 mRNA. Translation: BAA37087.1 . Frameshift.
    AK006326 mRNA. Translation: BAB24527.1 .
    AK088285 mRNA. Translation: BAC40258.1 .
    AC122820 Genomic DNA. No translation available.
    BC023009 mRNA. Translation: AAH23009.1 . Different initiation.
    CCDSi CCDS39682.1. [Q8R1W2-2 ]
    CCDS39683.1. [Q8R1W2-4 ]
    RefSeqi NP_001074021.1. NM_001080552.1. [Q8R1W2-2 ]
    NP_001074022.1. NM_001080553.1. [Q8R1W2-4 ]
    NP_034482.2. NM_010352.2. [Q8R1W2-4 ]
    UniGenei Mm.272306.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 200083. 1 interaction.
    IntActi Q8R1W2. 3 interactions.
    MINTi MINT-6167922.

    PTM databases

    PhosphoSitei Q8R1W2.

    Proteomic databases

    PRIDEi Q8R1W2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000087729 ; ENSMUSP00000085022 ; ENSMUSG00000030206 . [Q8R1W2-2 ]
    ENSMUST00000111910 ; ENSMUSP00000107541 ; ENSMUSG00000030206 . [Q8R1W2-4 ]
    ENSMUST00000111911 ; ENSMUSP00000107542 ; ENSMUSG00000030206 . [Q8R1W2-4 ]
    GeneIDi 14840.
    KEGGi mmu:14840.
    UCSCi uc009elj.1. mouse. [Q8R1W2-2 ]
    uc009elk.1. mouse. [Q8R1W2-4 ]

    Organism-specific databases

    CTDi 83445.
    MGIi MGI:1194499. Gsg1.

    Phylogenomic databases

    eggNOGi NOG47621.
    GeneTreei ENSGT00390000011933.
    HOGENOMi HOG000112826.
    HOVERGENi HBG069545.
    OMAi WNYGWAF.
    OrthoDBi EOG715Q4M.
    PhylomeDBi Q8R1W2.
    TreeFami TF331388.

    Miscellaneous databases

    NextBioi 287055.
    PROi Q8R1W2.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8R1W2.
    Genevestigatori Q8R1W2.

    Family and domain databases

    InterProi IPR012478. GSG-1.
    [Graphical view ]
    Pfami PF07803. GSG-1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Isolation and characterization of cDNA clones specifically expressed in testicular germ cells."
      Tanaka H., Yoshimura Y., Nishina Y., Nozaki M., Nojima H., Nishimune Y.
      FEBS Lett. 355:4-10(1994) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY.
      Strain: C57BL/6.
      Tissue: Testis.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Strain: C57BL/6.
      Tissue: Testis.
    3. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Strain: C57BL/6J and NOD.
      Tissue: Testis and Thymus.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Eye.
    6. "Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions."
      Choi H.-S., Lee S.-H., Kim H., Lee Y.
      FEBS Lett. 582:1203-1209(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH PAPOLB, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiGSG1_MOUSE
    AccessioniPrimary (citable) accession number: Q8R1W2
    Secondary accession number(s): Q8C2N5, Q9D9Z3, Q9Z1H7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 29, 2008
    Last sequence update: April 29, 2008
    Last modified: October 1, 2014
    This is version 72 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3