Q8R1W2 (GSG1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 61.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Germ cell-specific gene 1 protein Alternative name(s): Germ cell-associated protein 1 | ||
| Gene names |
| ||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||
| Taxonomic identifier | 10090 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 324 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May cause the redistribution of PAPOLB from the cytosol to the endoplasmic reticulum. Ref.6 |
| Subunit structure | Interacts with PAPOLB. Ref.6 |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Note: Colocalizes with PAPOLB in the endoplasmic reticulum. Ref.6 |
| Tissue specificity | Expressed in spermatogenic cells (at protein level). Expressed in germ cells within the testis from day 21 onwards. Ref.1 Ref.6 |
| Sequence similarities | Belongs to the GSG1 family. |
| Sequence caution | The sequence AAH23009.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA37087.1 differs from that shown. Reason: Frameshift at several positions. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | endoplasmic reticulum Inferred from direct assay Ref.6. Source: MGI endoplasmic reticulum membraneInferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8R1W2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8R1W2-2) The sequence of this isoform differs from the canonical sequence as follows: 125-125: R → RGEKGLLEFATLQGSCHPTLRFGGEWLMEKASLLHLPWGPVAKVF | ||||||
| Isoform 3 (identifier: Q8R1W2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-107: Missing. 108-125: EPGEKCRRFIELTPPAQR → MEKASLLHLPWGPVAKVF | ||||||
| Isoform 4 (identifier: Q8R1W2-4) The sequence of this isoform differs from the canonical sequence as follows: 1-4: MAKM → M 125-125: R → RGEKGLLEFATLQGSCHPTLRFGGEWLMEKASLLHLPWGPVAKVF |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 324 | 324 | Germ cell-specific gene 1 protein | PRO_0000329462 | |||||
Regions | |||||||||
| Transmembrane | 15 – 35 | 21 | Helical; Potential | ||||||
| Transmembrane | 127 – 147 | 21 | Helical; Potential | ||||||
| Transmembrane | 164 – 184 | 21 | Helical; Potential | ||||||
| Transmembrane | 208 – 228 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 107 | 107 | Missing in isoform 3. | VSP_032999 | |||||
| Alternative sequence | 1 – 4 | 4 | MAKM → M in isoform 4. | VSP_032998 | |||||
| Alternative sequence | 108 – 125 | 18 | EPGEK…PPAQR → MEKASLLHLPWGPVAKVF in isoform 3. | VSP_033000 | |||||
| Alternative sequence | 125 | 1 | R → RGEKGLLEFATLQGSCHPTL RFGGEWLMEKASLLHLPWGP VAKVF in isoform 2 and isoform 4. | VSP_033001 | |||||
Experimental info | |||||||||
| Sequence conflict | 178 | 1 | M → I in BAC40258. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation and characterization of cDNA clones specifically expressed in testicular germ cells." Tanaka H., Yoshimura Y., Nishina Y., Nozaki M., Nojima H., Nishimune Y. FEBS Lett. 355:4-10(1994) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY. Strain: C57BL/6. Tissue: Testis. |
| [2] | "Mapping of six germ-cell-specific genes to mouse chromosomes." Matsui M., Ichihara H., Kobayashi S., Tanaka H., Tsuchida J., Nozaki M., Yoshimura Y., Nojima H., Rochelle J.M., Nishimune Y., Taketo M.M., Seldin M.F. Mamm. Genome 8:873-874(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Strain: C57BL/6. Tissue: Testis. |
| [3] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Strain: C57BL/6J and NOD. Tissue: Testis and Thymus. |
| [4] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Eye. |
| [6] | "Germ cell-specific gene 1 targets testis-specific poly(A) polymerase to the endoplasmic reticulum through protein-protein interactions." Choi H.-S., Lee S.-H., Kim H., Lee Y. FEBS Lett. 582:1203-1209(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH PAPOLB, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | D87325 mRNA. Translation: BAA37087.1. Frameshift. AK006326 mRNA. Translation: BAB24527.1. AK088285 mRNA. Translation: BAC40258.1. AC122820 Genomic DNA. No translation available. BC023009 mRNA. Translation: AAH23009.1. Different initiation. |
| IPI | IPI00153480. IPI00828917. IPI00857678. IPI00890842. |
| RefSeq | NP_001074021.1. NM_001080552.1. NP_001074022.1. NM_001080553.1. NP_034482.2. NM_010352.2. |
| UniGene | Mm.272306. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-6167922. |
PTM databases | |
| PhosphoSite | Q8R1W2. |
Proteomic databases | |
| PRIDE | Q8R1W2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000087729; ENSMUSP00000085022; ENSMUSG00000030206. ENSMUST00000111910; ENSMUSP00000107541; ENSMUSG00000030206. ENSMUST00000111911; ENSMUSP00000107542; ENSMUSG00000030206. |
| GeneID | 14840. |
| KEGG | mmu:14840. |
| UCSC | uc009elj.1. mouse. uc009elk.1. mouse. |
Organism-specific databases | |
| CTD | 83445. |
| MGI | MGI:1194499. Gsg1. |
Phylogenomic databases | |
| eggNOG | NOG47621. |
| GeneTree | ENSGT00390000011933. |
| HOGENOM | HOG000112826. |
| HOVERGEN | HBG069545. |
| OMA | WNYGWAF. |
| OrthoDB | EOG42822J. |
Gene expression databases | |
| ArrayExpress | Q8R1W2. |
| Bgee | Q8R1W2. |
| Genevestigator | Q8R1W2. |
Family and domain databases | |
| InterPro | IPR012478. GSG-1. [Graphical view] |
| Pfam | PF07803. GSG-1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 287055. |
| SOURCE | Search... |
Entry information
| Entry name | GSG1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8R1W2 Secondary accession number(s): Q8C2N5, Q9D9Z3, Q9Z1H7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
