Q8R0S4 (CACB4_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
November 16, 2011.
Version 85.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Voltage-dependent L-type calcium channel subunit beta-4 Short name=CAB4 Alternative name(s): Calcium channel voltage-dependent subunit beta 4 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus |
Protein attributes
| Sequence length | 519 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting By similarity. |
| Subunit structure | The L-type calcium channel is composed of four subunits: alpha-1, alpha-2, beta and gamma. Interacts with FASLG By similarity. |
| Sequence similarities | Belongs to the calcium channel beta subunit family. Contains 1 SH3 domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 3 (identifier: Q8R0S4-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q8R0S4-1) The sequence of this isoform differs from the canonical sequence as follows: 1-48: MSSSYGKNGAADGPHSPSSQVARGTTTRRSRLKRSDGSTTSTSFILRQ → MYDNLYLHGVEDSEA | ||||||
| Isoform 2 (identifier: Q8R0S4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-48: MSSSYGKNGAADGPHSPSSQVARGTTTRRSRLKRSDGSTTSTSFILRQ → MA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 519 | 519 | Voltage-dependent L-type calcium channel subunit beta-4 | PRO_0000144061 | |||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 98 – 160 | 63 | SH3 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 38 | 1 | Phosphoserine Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 404 | 1 | Phosphoserine Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 405 | 1 | Phosphoserine Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 410 | 1 | Phosphothreonine Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 507 | 1 | Phosphoserine Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 48 | 48 | MSSSY…FILRQ → MYDNLYLHGVEDSEA in isoform 1. | VSP_022599 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 48 | 48 | MSSSY…FILRQ → MA in isoform 2. | VSP_010737 | |||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 492 | 1 | P → A in BAC31681. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 72 – 88 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 94 – 100 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 124 – 132 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 135 – 142 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 148 – 151 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 153 – 161 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 162 – 164 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 211 – 215 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 221 – 224 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 232 – 248 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 249 – 251 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 252 – 258 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 262 – 264 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 288 – 302 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 307 – 312 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 318 – 321 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 329 – 333 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 338 – 346 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 350 – 353 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 356 – 367 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 371 – 373 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 375 – 378 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 380 – 382 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 383 – 401 | 19 | |||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Structures of the murine genes for the beta1- and beta4-Subunits of the voltage-dependent calcium channel." Murakami M., Miyoshi I., Suzuki T., Sasano H., Iijima T. J. Mol. Neurosci. 21:13-22(2003) [PubMed: 14500989] [Abstract] Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1). |
| [2] | "The transcriptional landscape of the mammalian genome." Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005) [PubMed: 16141072] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Strain: C57BL/6J. Tissue: Brain cortex, Hypothalamus and Spinal cord. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye. |
| [4] | "Proteomic analysis of in vivo phosphorylated synaptic proteins." Collins M.O., Yu L., Coba M.P., Husi H., Campuzano I., Blackstock W.P., Choudhary J.S., Grant S.G. J. Biol. Chem. 280:5972-5982(2005) [PubMed: 15572359] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-404 AND THR-410, MASS SPECTROMETRY. Tissue: Forebrain. |
| [5] | "Comprehensive identification of phosphorylation sites in postsynaptic density preparations." Trinidad J.C., Specht C.G., Thalhammer A., Schoepfer R., Burlingame A.L. Mol. Cell. Proteomics 5:914-922(2006) [PubMed: 16452087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-507, MASS SPECTROMETRY. Tissue: Brain. |
| [6] | "Qualitative and quantitative analyses of protein phosphorylation in naive and stimulated mouse synaptosomal preparations." Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F., Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D., Gerrits B., Panse C., Schlapbach R., Mansuy I.M. Mol. Cell. Proteomics 6:283-293(2007) [PubMed: 17114649] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-38 AND SER-405, MASS SPECTROMETRY. Tissue: Brain cortex. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB100402 Genomic DNA. Translation: BAC80139.1. AK038633 mRNA. Translation: BAC30073.1. AK043850 mRNA. Translation: BAC31681.1. AK079616 mRNA. Translation: BAC37703.1. AK147338 mRNA. Translation: BAE27855.1. BC026479 mRNA. Translation: AAH26479.1. | ||||||||||||
| IPI | IPI00131720. IPI00473235. IPI00626660. | ||||||||||||
| RefSeq | NP_001032176.1. NM_001037099.1. NP_666235.1. NM_146123.2. | ||||||||||||
| UniGene | Mm.330223. Mm.472778. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q8R0S4. | ||||||||||||
| SMR | Q8R0S4. Positions 49-402. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q8R0S4. 6 interactions. | ||||||||||||
| STRING | Q8R0S4. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q8R0S4. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q8R0S4. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSMUST00000078324; ENSMUSP00000077438; ENSMUSG00000017412. ENSMUST00000102760; ENSMUSP00000099821; ENSMUSG00000017412. ENSMUST00000102761; ENSMUSP00000099822; ENSMUSG00000017412. | ||||||||||||
| GeneID | 12298. | ||||||||||||
| KEGG | mmu:12298. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 785. | ||||||||||||
| MGI | MGI:103301. Cacnb4. | ||||||||||||
Phylogenomic databases | |||||||||||||
| GeneTree | ENSGT00390000002740. | ||||||||||||
| HOGENOM | HBG445475. | ||||||||||||
| HOVERGEN | HBG050765. | ||||||||||||
| InParanoid | Q8R0S4. | ||||||||||||
| OMA | PLVEEEY. | ||||||||||||
| OrthoDB | EOG4GQQ4X. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q8R0S4. | ||||||||||||
| Bgee | Q8R0S4. | ||||||||||||
| Genevestigator | Q8R0S4. | ||||||||||||
| GermOnline | ENSMUSG00000017412. Mus musculus. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR008144. Guanylate_kin. IPR008145. Guanylate_kin/L-typ_Ca_channel. IPR001452. SH3_domain. IPR000584. VDCC_L_bsu. [Graphical view] | ||||||||||||
| KO | K04865. | ||||||||||||
| PANTHER | PTHR11824. Ca_channel_B. 1 hit. | ||||||||||||
| Pfam | PF00625. Guanylate_kin. 1 hit. PF12052. VGCC_beta4Aa_N. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR01626. LCACHANNELB. | ||||||||||||
| SMART | SM00072. GuKc. 1 hit. SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF50044. SH3. 1 hit. | ||||||||||||
| PROSITE | PS50002. SH3. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 280812. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CACB4_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8R0S4 Secondary accession number(s): Q3UHK2, Q8BRN6, Q8CAJ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with