Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Monocarboxylate transporter 5

Gene

Slc16a4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Symport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Monocarboxylate transporter 5
Short name:
MCT 5
Gene namesi
Name:Slc16a4
Synonyms:Mct5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589 Componenti: Chromosome 3

Organism-specific databases

MGIiMGI:2385183. Slc16a4.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1616CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei17 – 3721HelicalSequence AnalysisAdd
BLAST
Topological domaini38 – 5821ExtracellularSequence AnalysisAdd
BLAST
Transmembranei59 – 7921HelicalSequence AnalysisAdd
BLAST
Topological domaini80 – 878CytoplasmicSequence Analysis
Transmembranei88 – 10821HelicalSequence AnalysisAdd
BLAST
Topological domaini109 – 1091ExtracellularSequence Analysis
Transmembranei110 – 12920HelicalSequence AnalysisAdd
BLAST
Topological domaini130 – 15324CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei154 – 17421HelicalSequence AnalysisAdd
BLAST
Topological domaini175 – 1751ExtracellularSequence Analysis
Transmembranei176 – 19520HelicalSequence AnalysisAdd
BLAST
Topological domaini196 – 304109CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei305 – 32521HelicalSequence AnalysisAdd
BLAST
Topological domaini326 – 34217ExtracellularSequence AnalysisAdd
BLAST
Transmembranei343 – 36321HelicalSequence AnalysisAdd
BLAST
Topological domaini364 – 37411CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei375 – 39521HelicalSequence AnalysisAdd
BLAST
Topological domaini396 – 3961ExtracellularSequence Analysis
Transmembranei397 – 41620HelicalSequence AnalysisAdd
BLAST
Topological domaini417 – 43014CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei431 – 45121HelicalSequence AnalysisAdd
BLAST
Topological domaini452 – 46312ExtracellularSequence AnalysisAdd
BLAST
Transmembranei464 – 48421HelicalSequence AnalysisAdd
BLAST
Topological domaini485 – 50016CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 500500Monocarboxylate transporter 5PRO_0000416125Add
BLAST

Proteomic databases

PRIDEiQ8R0M8.

PTM databases

PhosphoSiteiQ8R0M8.

Expressioni

Gene expression databases

BgeeiQ8R0M8.
GenevisibleiQ8R0M8. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000029502.

Structurei

3D structure databases

ProteinModelPortaliQ8R0M8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000118926.
HOGENOMiHOG000059591.
HOVERGENiHBG006385.
InParanoidiQ8R0M8.
KOiK08181.
OMAiCVTMGFL.
OrthoDBiEOG7NGQBB.
PhylomeDBiQ8R0M8.
TreeFamiTF313792.

Family and domain databases

InterProiIPR011701. MFS.
IPR020846. MFS_dom.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8R0M8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKKEKTPSP YTKPLDGGWG WMVVLHFFLV NVFVMGMTKT FAIFFVVFQE
60 70 80 90 100
EFEGTSEQIG WIGSIMSSLR FSAGPLAAII CDVLGEKATS ILGTFLVSGG
110 120 130 140 150
YVISSWATGI PFLCVTMGLL PGLGSAFLYQ VAAVVITKYF KKRLGLSTAI
160 170 180 190 200
ARSGMGLTFL LAPFTKFLID LYDWTGALIL FGAIILNLVP SSMLLRPIHS
210 220 230 240 250
QSNNNSDIEN KGSILSATEP EASYKTETSK CKETQEPFIK DSTMKKSEQP
260 270 280 290 300
TTTLTVLGNQ SEEFSNRPHR NRPLLMSNGK SHKKKFVSWN CKQKLLDISL
310 320 330 340 350
FRNPFFYIFT WSFLLSQLAY FIPTFHLVAR AKTLGIDVMD ASYLVSVAGI
360 370 380 390 400
TETVSQLISG WIADQNWIKK YQYHKSYLIL CGVTNLLAPL ATTFPLLMAY
410 420 430 440 450
TILFAIFAGG YLALILPVLV DLSKNSRVHK FLGYASFFAG IAVLSGPPIA
460 470 480 490 500
GWIYDYTQTY TGSFYFSGTC YILSSVSLFF VPLAERWKRK QSDLLRTTIK
Length:500
Mass (Da):55,678
Last modified:June 1, 2002 - v1
Checksum:i80B0FFF7D0C652E7
GO
Isoform 2 (identifier: Q8R0M8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     451-500: GWIYDYTQTYTGSFYFSGTCYILSSVSLFFVPLAERWKRKQSDLLRTTIK → DVTHGWTTYLMHMKPLKT

Note: No experimental confirmation available.
Show »
Length:468
Mass (Da):51,899
Checksum:i7FF2E4895F05836F
GO
Isoform 3 (identifier: Q8R0M8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     350-500: ITETVSQLIS...QSDLLRTTIK → KKNELSLIKVY

Note: No experimental confirmation available.
Show »
Length:360
Mass (Da):40,028
Checksum:i423DCF37A5728068
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti366 – 3661N → D in BAC32495 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei350 – 500151ITETV…RTTIK → KKNELSLIKVY in isoform 3. 1 PublicationVSP_042510Add
BLAST
Alternative sequencei451 – 50050GWIYD…RTTIK → DVTHGWTTYLMHMKPLKT in isoform 2. 1 PublicationVSP_042511Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK045797 mRNA. Translation: BAC32495.1.
AK049873 mRNA. Translation: BAC33967.1.
AK052779 mRNA. Translation: BAC35143.1.
AK085492 mRNA. Translation: BAC39456.1.
AK136837 mRNA. Translation: BAE23142.1.
AC132405 Genomic DNA. No translation available.
CH466607 Genomic DNA. Translation: EDL01900.1.
BC025441 mRNA. Translation: AAH25441.1.
BC026596 mRNA. Translation: AAH26596.1.
CCDSiCCDS17736.1. [Q8R0M8-1]
RefSeqiNP_666248.1. NM_146136.1. [Q8R0M8-1]
XP_011238407.1. XM_011240105.1. [Q8R0M8-2]
UniGeneiMm.38384.

Genome annotation databases

EnsembliENSMUST00000029502; ENSMUSP00000029502; ENSMUSG00000027896. [Q8R0M8-1]
ENSMUST00000106723; ENSMUSP00000102334; ENSMUSG00000027896. [Q8R0M8-2]
GeneIDi229699.
KEGGimmu:229699.
UCSCiuc008qwx.1. mouse. [Q8R0M8-3]
uc008qwy.2. mouse. [Q8R0M8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK045797 mRNA. Translation: BAC32495.1.
AK049873 mRNA. Translation: BAC33967.1.
AK052779 mRNA. Translation: BAC35143.1.
AK085492 mRNA. Translation: BAC39456.1.
AK136837 mRNA. Translation: BAE23142.1.
AC132405 Genomic DNA. No translation available.
CH466607 Genomic DNA. Translation: EDL01900.1.
BC025441 mRNA. Translation: AAH25441.1.
BC026596 mRNA. Translation: AAH26596.1.
CCDSiCCDS17736.1. [Q8R0M8-1]
RefSeqiNP_666248.1. NM_146136.1. [Q8R0M8-1]
XP_011238407.1. XM_011240105.1. [Q8R0M8-2]
UniGeneiMm.38384.

3D structure databases

ProteinModelPortaliQ8R0M8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000029502.

PTM databases

PhosphoSiteiQ8R0M8.

Proteomic databases

PRIDEiQ8R0M8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000029502; ENSMUSP00000029502; ENSMUSG00000027896. [Q8R0M8-1]
ENSMUST00000106723; ENSMUSP00000102334; ENSMUSG00000027896. [Q8R0M8-2]
GeneIDi229699.
KEGGimmu:229699.
UCSCiuc008qwx.1. mouse. [Q8R0M8-3]
uc008qwy.2. mouse. [Q8R0M8-1]

Organism-specific databases

CTDi9122.
MGIiMGI:2385183. Slc16a4.

Phylogenomic databases

GeneTreeiENSGT00760000118926.
HOGENOMiHOG000059591.
HOVERGENiHBG006385.
InParanoidiQ8R0M8.
KOiK08181.
OMAiCVTMGFL.
OrthoDBiEOG7NGQBB.
PhylomeDBiQ8R0M8.
TreeFamiTF313792.

Miscellaneous databases

ChiTaRSiSlc16a4. mouse.
NextBioi379615.
PROiQ8R0M8.
SOURCEiSearch...

Gene expression databases

BgeeiQ8R0M8.
GenevisibleiQ8R0M8. MM.

Family and domain databases

InterProiIPR011701. MFS.
IPR020846. MFS_dom.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Strain: C57BL/6J.
    Tissue: Corpora quadrigemina, Diencephalon, Hippocampus and Kidney.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: FVB/N.
    Tissue: Kidney.
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiMOT5_MOUSE
AccessioniPrimary (citable) accession number: Q8R0M8
Secondary accession number(s): Q8BLA5, Q8BWE3, Q8R157
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2012
Last sequence update: June 1, 2002
Last modified: July 22, 2015
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.