Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8R0M8

- MOT5_MOUSE

UniProt

Q8R0M8 - MOT5_MOUSE

Protein

Monocarboxylate transporter 5

Gene

Slc16a4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 91 (01 Oct 2014)
      Sequence version 1 (01 Jun 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate By similarity.By similarity

    GO - Molecular functioni

    1. symporter activity Source: UniProtKB-KW

    Keywords - Biological processi

    Symport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Monocarboxylate transporter 5
    Short name:
    MCT 5
    Gene namesi
    Name:Slc16a4
    Synonyms:Mct5
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 3

    Organism-specific databases

    MGIiMGI:2385183. Slc16a4.

    Subcellular locationi

    Cell membrane By similarity; Multi-pass membrane protein By similarity

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 500500Monocarboxylate transporter 5PRO_0000416125Add
    BLAST

    Proteomic databases

    PRIDEiQ8R0M8.

    PTM databases

    PhosphoSiteiQ8R0M8.

    Expressioni

    Gene expression databases

    BgeeiQ8R0M8.
    GenevestigatoriQ8R0M8.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8R0M8.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 1616CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini38 – 5821ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini80 – 878CytoplasmicSequence Analysis
    Topological domaini109 – 1091ExtracellularSequence Analysis
    Topological domaini130 – 15324CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini175 – 1751ExtracellularSequence Analysis
    Topological domaini196 – 304109CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini326 – 34217ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini364 – 37411CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini396 – 3961ExtracellularSequence Analysis
    Topological domaini417 – 43014CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini452 – 46312ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini485 – 50016CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei17 – 3721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei59 – 7921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei88 – 10821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei110 – 12920HelicalSequence AnalysisAdd
    BLAST
    Transmembranei154 – 17421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei176 – 19520HelicalSequence AnalysisAdd
    BLAST
    Transmembranei305 – 32521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei343 – 36321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei375 – 39521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei397 – 41620HelicalSequence AnalysisAdd
    BLAST
    Transmembranei431 – 45121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei464 – 48421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    GeneTreeiENSGT00740000114926.
    HOGENOMiHOG000059591.
    HOVERGENiHBG006385.
    InParanoidiQ8R0M8.
    KOiK08181.
    OMAiAVVITKY.
    OrthoDBiEOG7NGQBB.
    PhylomeDBiQ8R0M8.
    TreeFamiTF313792.

    Family and domain databases

    InterProiIPR011701. MFS.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    [Graphical view]
    PfamiPF07690. MFS_1. 1 hit.
    [Graphical view]
    SUPFAMiSSF103473. SSF103473. 2 hits.
    PROSITEiPS50850. MFS. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8R0M8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVKKEKTPSP YTKPLDGGWG WMVVLHFFLV NVFVMGMTKT FAIFFVVFQE    50
    EFEGTSEQIG WIGSIMSSLR FSAGPLAAII CDVLGEKATS ILGTFLVSGG 100
    YVISSWATGI PFLCVTMGLL PGLGSAFLYQ VAAVVITKYF KKRLGLSTAI 150
    ARSGMGLTFL LAPFTKFLID LYDWTGALIL FGAIILNLVP SSMLLRPIHS 200
    QSNNNSDIEN KGSILSATEP EASYKTETSK CKETQEPFIK DSTMKKSEQP 250
    TTTLTVLGNQ SEEFSNRPHR NRPLLMSNGK SHKKKFVSWN CKQKLLDISL 300
    FRNPFFYIFT WSFLLSQLAY FIPTFHLVAR AKTLGIDVMD ASYLVSVAGI 350
    TETVSQLISG WIADQNWIKK YQYHKSYLIL CGVTNLLAPL ATTFPLLMAY 400
    TILFAIFAGG YLALILPVLV DLSKNSRVHK FLGYASFFAG IAVLSGPPIA 450
    GWIYDYTQTY TGSFYFSGTC YILSSVSLFF VPLAERWKRK QSDLLRTTIK 500
    Length:500
    Mass (Da):55,678
    Last modified:June 1, 2002 - v1
    Checksum:i80B0FFF7D0C652E7
    GO
    Isoform 2 (identifier: Q8R0M8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         451-500: GWIYDYTQTYTGSFYFSGTCYILSSVSLFFVPLAERWKRKQSDLLRTTIK → DVTHGWTTYLMHMKPLKT

    Note: No experimental confirmation available.

    Show »
    Length:468
    Mass (Da):51,899
    Checksum:i7FF2E4895F05836F
    GO
    Isoform 3 (identifier: Q8R0M8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         350-500: ITETVSQLIS...QSDLLRTTIK → KKNELSLIKVY

    Note: No experimental confirmation available.

    Show »
    Length:360
    Mass (Da):40,028
    Checksum:i423DCF37A5728068
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti366 – 3661N → D in BAC32495. (PubMed:16141072)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei350 – 500151ITETV…RTTIK → KKNELSLIKVY in isoform 3. 1 PublicationVSP_042510Add
    BLAST
    Alternative sequencei451 – 50050GWIYD…RTTIK → DVTHGWTTYLMHMKPLKT in isoform 2. 1 PublicationVSP_042511Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK045797 mRNA. Translation: BAC32495.1.
    AK049873 mRNA. Translation: BAC33967.1.
    AK052779 mRNA. Translation: BAC35143.1.
    AK085492 mRNA. Translation: BAC39456.1.
    AK136837 mRNA. Translation: BAE23142.1.
    AC132405 Genomic DNA. No translation available.
    CH466607 Genomic DNA. Translation: EDL01900.1.
    BC025441 mRNA. Translation: AAH25441.1.
    BC026596 mRNA. Translation: AAH26596.1.
    CCDSiCCDS17736.1. [Q8R0M8-1]
    RefSeqiNP_666248.1. NM_146136.1. [Q8R0M8-1]
    UniGeneiMm.38384.

    Genome annotation databases

    EnsembliENSMUST00000029502; ENSMUSP00000029502; ENSMUSG00000027896. [Q8R0M8-1]
    ENSMUST00000106723; ENSMUSP00000102334; ENSMUSG00000027896. [Q8R0M8-2]
    GeneIDi229699.
    KEGGimmu:229699.
    UCSCiuc008qwx.1. mouse. [Q8R0M8-3]
    uc008qwy.2. mouse. [Q8R0M8-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK045797 mRNA. Translation: BAC32495.1 .
    AK049873 mRNA. Translation: BAC33967.1 .
    AK052779 mRNA. Translation: BAC35143.1 .
    AK085492 mRNA. Translation: BAC39456.1 .
    AK136837 mRNA. Translation: BAE23142.1 .
    AC132405 Genomic DNA. No translation available.
    CH466607 Genomic DNA. Translation: EDL01900.1 .
    BC025441 mRNA. Translation: AAH25441.1 .
    BC026596 mRNA. Translation: AAH26596.1 .
    CCDSi CCDS17736.1. [Q8R0M8-1 ]
    RefSeqi NP_666248.1. NM_146136.1. [Q8R0M8-1 ]
    UniGenei Mm.38384.

    3D structure databases

    ProteinModelPortali Q8R0M8.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q8R0M8.

    Proteomic databases

    PRIDEi Q8R0M8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000029502 ; ENSMUSP00000029502 ; ENSMUSG00000027896 . [Q8R0M8-1 ]
    ENSMUST00000106723 ; ENSMUSP00000102334 ; ENSMUSG00000027896 . [Q8R0M8-2 ]
    GeneIDi 229699.
    KEGGi mmu:229699.
    UCSCi uc008qwx.1. mouse. [Q8R0M8-3 ]
    uc008qwy.2. mouse. [Q8R0M8-1 ]

    Organism-specific databases

    CTDi 9122.
    MGIi MGI:2385183. Slc16a4.

    Phylogenomic databases

    GeneTreei ENSGT00740000114926.
    HOGENOMi HOG000059591.
    HOVERGENi HBG006385.
    InParanoidi Q8R0M8.
    KOi K08181.
    OMAi AVVITKY.
    OrthoDBi EOG7NGQBB.
    PhylomeDBi Q8R0M8.
    TreeFami TF313792.

    Miscellaneous databases

    NextBioi 379615.
    PROi Q8R0M8.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8R0M8.
    Genevestigatori Q8R0M8.

    Family and domain databases

    InterProi IPR011701. MFS.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    [Graphical view ]
    Pfami PF07690. MFS_1. 1 hit.
    [Graphical view ]
    SUPFAMi SSF103473. SSF103473. 2 hits.
    PROSITEi PS50850. MFS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The transcriptional landscape of the mammalian genome."
      Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
      , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
      Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Strain: C57BL/6J.
      Tissue: Corpora quadrigemina, Diencephalon, Hippocampus and Kidney.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Strain: FVB/N.
      Tissue: Kidney.
    4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
      Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiMOT5_MOUSE
    AccessioniPrimary (citable) accession number: Q8R0M8
    Secondary accession number(s): Q8BLA5, Q8BWE3, Q8R157
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 21, 2012
    Last sequence update: June 1, 2002
    Last modified: October 1, 2014
    This is version 91 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3