Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8R0M8

- MOT5_MOUSE

UniProt

Q8R0M8 - MOT5_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Monocarboxylate transporter 5

Gene

Slc16a4

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Functioni

Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate (By similarity).By similarity

GO - Molecular functioni

  1. symporter activity Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Symport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Monocarboxylate transporter 5
Short name:
MCT 5
Gene namesi
Name:Slc16a4
Synonyms:Mct5
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 3

Organism-specific databases

MGIiMGI:2385183. Slc16a4.

Subcellular locationi

Cell membrane By similarity; Multi-pass membrane protein By similarity

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 500500Monocarboxylate transporter 5PRO_0000416125Add
BLAST

Proteomic databases

PRIDEiQ8R0M8.

PTM databases

PhosphoSiteiQ8R0M8.

Expressioni

Gene expression databases

BgeeiQ8R0M8.
GenevestigatoriQ8R0M8.

Structurei

3D structure databases

ProteinModelPortaliQ8R0M8.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1616CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini38 – 5821ExtracellularSequence AnalysisAdd
BLAST
Topological domaini80 – 878CytoplasmicSequence Analysis
Topological domaini109 – 1091ExtracellularSequence Analysis
Topological domaini130 – 15324CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini175 – 1751ExtracellularSequence Analysis
Topological domaini196 – 304109CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini326 – 34217ExtracellularSequence AnalysisAdd
BLAST
Topological domaini364 – 37411CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini396 – 3961ExtracellularSequence Analysis
Topological domaini417 – 43014CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini452 – 46312ExtracellularSequence AnalysisAdd
BLAST
Topological domaini485 – 50016CytoplasmicSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei17 – 3721HelicalSequence AnalysisAdd
BLAST
Transmembranei59 – 7921HelicalSequence AnalysisAdd
BLAST
Transmembranei88 – 10821HelicalSequence AnalysisAdd
BLAST
Transmembranei110 – 12920HelicalSequence AnalysisAdd
BLAST
Transmembranei154 – 17421HelicalSequence AnalysisAdd
BLAST
Transmembranei176 – 19520HelicalSequence AnalysisAdd
BLAST
Transmembranei305 – 32521HelicalSequence AnalysisAdd
BLAST
Transmembranei343 – 36321HelicalSequence AnalysisAdd
BLAST
Transmembranei375 – 39521HelicalSequence AnalysisAdd
BLAST
Transmembranei397 – 41620HelicalSequence AnalysisAdd
BLAST
Transmembranei431 – 45121HelicalSequence AnalysisAdd
BLAST
Transmembranei464 – 48421HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00760000118926.
HOGENOMiHOG000059591.
HOVERGENiHBG006385.
InParanoidiQ8R0M8.
KOiK08181.
OMAiAVVITKY.
OrthoDBiEOG7NGQBB.
PhylomeDBiQ8R0M8.
TreeFamiTF313792.

Family and domain databases

InterProiIPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
[Graphical view]
PfamiPF07690. MFS_1. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 2 hits.
PROSITEiPS50850. MFS. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8R0M8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKKEKTPSP YTKPLDGGWG WMVVLHFFLV NVFVMGMTKT FAIFFVVFQE
60 70 80 90 100
EFEGTSEQIG WIGSIMSSLR FSAGPLAAII CDVLGEKATS ILGTFLVSGG
110 120 130 140 150
YVISSWATGI PFLCVTMGLL PGLGSAFLYQ VAAVVITKYF KKRLGLSTAI
160 170 180 190 200
ARSGMGLTFL LAPFTKFLID LYDWTGALIL FGAIILNLVP SSMLLRPIHS
210 220 230 240 250
QSNNNSDIEN KGSILSATEP EASYKTETSK CKETQEPFIK DSTMKKSEQP
260 270 280 290 300
TTTLTVLGNQ SEEFSNRPHR NRPLLMSNGK SHKKKFVSWN CKQKLLDISL
310 320 330 340 350
FRNPFFYIFT WSFLLSQLAY FIPTFHLVAR AKTLGIDVMD ASYLVSVAGI
360 370 380 390 400
TETVSQLISG WIADQNWIKK YQYHKSYLIL CGVTNLLAPL ATTFPLLMAY
410 420 430 440 450
TILFAIFAGG YLALILPVLV DLSKNSRVHK FLGYASFFAG IAVLSGPPIA
460 470 480 490 500
GWIYDYTQTY TGSFYFSGTC YILSSVSLFF VPLAERWKRK QSDLLRTTIK
Length:500
Mass (Da):55,678
Last modified:June 1, 2002 - v1
Checksum:i80B0FFF7D0C652E7
GO
Isoform 2 (identifier: Q8R0M8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     451-500: GWIYDYTQTYTGSFYFSGTCYILSSVSLFFVPLAERWKRKQSDLLRTTIK → DVTHGWTTYLMHMKPLKT

Note: No experimental confirmation available.

Show »
Length:468
Mass (Da):51,899
Checksum:i7FF2E4895F05836F
GO
Isoform 3 (identifier: Q8R0M8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     350-500: ITETVSQLIS...QSDLLRTTIK → KKNELSLIKVY

Note: No experimental confirmation available.

Show »
Length:360
Mass (Da):40,028
Checksum:i423DCF37A5728068
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti366 – 3661N → D in BAC32495. (PubMed:16141072)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei350 – 500151ITETV…RTTIK → KKNELSLIKVY in isoform 3. 1 PublicationVSP_042510Add
BLAST
Alternative sequencei451 – 50050GWIYD…RTTIK → DVTHGWTTYLMHMKPLKT in isoform 2. 1 PublicationVSP_042511Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK045797 mRNA. Translation: BAC32495.1.
AK049873 mRNA. Translation: BAC33967.1.
AK052779 mRNA. Translation: BAC35143.1.
AK085492 mRNA. Translation: BAC39456.1.
AK136837 mRNA. Translation: BAE23142.1.
AC132405 Genomic DNA. No translation available.
CH466607 Genomic DNA. Translation: EDL01900.1.
BC025441 mRNA. Translation: AAH25441.1.
BC026596 mRNA. Translation: AAH26596.1.
CCDSiCCDS17736.1. [Q8R0M8-1]
RefSeqiNP_666248.1. NM_146136.1. [Q8R0M8-1]
UniGeneiMm.38384.

Genome annotation databases

EnsembliENSMUST00000029502; ENSMUSP00000029502; ENSMUSG00000027896. [Q8R0M8-1]
ENSMUST00000106723; ENSMUSP00000102334; ENSMUSG00000027896. [Q8R0M8-2]
GeneIDi229699.
KEGGimmu:229699.
UCSCiuc008qwx.1. mouse. [Q8R0M8-3]
uc008qwy.2. mouse. [Q8R0M8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK045797 mRNA. Translation: BAC32495.1 .
AK049873 mRNA. Translation: BAC33967.1 .
AK052779 mRNA. Translation: BAC35143.1 .
AK085492 mRNA. Translation: BAC39456.1 .
AK136837 mRNA. Translation: BAE23142.1 .
AC132405 Genomic DNA. No translation available.
CH466607 Genomic DNA. Translation: EDL01900.1 .
BC025441 mRNA. Translation: AAH25441.1 .
BC026596 mRNA. Translation: AAH26596.1 .
CCDSi CCDS17736.1. [Q8R0M8-1 ]
RefSeqi NP_666248.1. NM_146136.1. [Q8R0M8-1 ]
UniGenei Mm.38384.

3D structure databases

ProteinModelPortali Q8R0M8.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q8R0M8.

Proteomic databases

PRIDEi Q8R0M8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000029502 ; ENSMUSP00000029502 ; ENSMUSG00000027896 . [Q8R0M8-1 ]
ENSMUST00000106723 ; ENSMUSP00000102334 ; ENSMUSG00000027896 . [Q8R0M8-2 ]
GeneIDi 229699.
KEGGi mmu:229699.
UCSCi uc008qwx.1. mouse. [Q8R0M8-3 ]
uc008qwy.2. mouse. [Q8R0M8-1 ]

Organism-specific databases

CTDi 9122.
MGIi MGI:2385183. Slc16a4.

Phylogenomic databases

GeneTreei ENSGT00760000118926.
HOGENOMi HOG000059591.
HOVERGENi HBG006385.
InParanoidi Q8R0M8.
KOi K08181.
OMAi AVVITKY.
OrthoDBi EOG7NGQBB.
PhylomeDBi Q8R0M8.
TreeFami TF313792.

Miscellaneous databases

NextBioi 379615.
PROi Q8R0M8.
SOURCEi Search...

Gene expression databases

Bgeei Q8R0M8.
Genevestigatori Q8R0M8.

Family and domain databases

InterProi IPR011701. MFS.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
[Graphical view ]
Pfami PF07690. MFS_1. 1 hit.
[Graphical view ]
SUPFAMi SSF103473. SSF103473. 2 hits.
PROSITEi PS50850. MFS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Strain: C57BL/6J.
    Tissue: Corpora quadrigemina, Diencephalon, Hippocampus and Kidney.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: FVB/N.
    Tissue: Kidney.
  4. Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.
    Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiMOT5_MOUSE
AccessioniPrimary (citable) accession number: Q8R0M8
Secondary accession number(s): Q8BLA5, Q8BWE3, Q8R157
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2012
Last sequence update: June 1, 2002
Last modified: October 29, 2014
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3