Q8R0M8 (MOT5_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Monocarboxylate transporter 5 Short name=MCT 5 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 500 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Proton-linked monocarboxylate transporter. Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate By similarity. |
| Subcellular location | Cell membrane; Multi-pass membrane protein By similarity. |
| Sequence similarities | Belongs to the major facilitator superfamily. Monocarboxylate porter (TC 2.A.1.13) family. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Symport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | symporter activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8R0M8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8R0M8-2) The sequence of this isoform differs from the canonical sequence as follows: 451-500: GWIYDYTQTYTGSFYFSGTCYILSSVSLFFVPLAERWKRKQSDLLRTTIK → DVTHGWTTYLMHMKPLKT | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8R0M8-3) The sequence of this isoform differs from the canonical sequence as follows: 350-500: ITETVSQLIS...QSDLLRTTIK → KKNELSLIKVY | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 500 | 500 | Monocarboxylate transporter 5 | PRO_0000416125 | |||||
Regions | |||||||||
| Topological domain | 1 – 16 | 16 | Cytoplasmic Potential | ||||||
| Transmembrane | 17 – 37 | 21 | Helical; Potential | ||||||
| Topological domain | 38 – 58 | 21 | Extracellular Potential | ||||||
| Transmembrane | 59 – 79 | 21 | Helical; Potential | ||||||
| Topological domain | 80 – 87 | 8 | Cytoplasmic Potential | ||||||
| Transmembrane | 88 – 108 | 21 | Helical; Potential | ||||||
| Topological domain | 109 | 1 | Extracellular Potential | ||||||
| Transmembrane | 110 – 129 | 20 | Helical; Potential | ||||||
| Topological domain | 130 – 153 | 24 | Cytoplasmic Potential | ||||||
| Transmembrane | 154 – 174 | 21 | Helical; Potential | ||||||
| Topological domain | 175 | 1 | Extracellular Potential | ||||||
| Transmembrane | 176 – 195 | 20 | Helical; Potential | ||||||
| Topological domain | 196 – 304 | 109 | Cytoplasmic Potential | ||||||
| Transmembrane | 305 – 325 | 21 | Helical; Potential | ||||||
| Topological domain | 326 – 342 | 17 | Extracellular Potential | ||||||
| Transmembrane | 343 – 363 | 21 | Helical; Potential | ||||||
| Topological domain | 364 – 374 | 11 | Cytoplasmic Potential | ||||||
| Transmembrane | 375 – 395 | 21 | Helical; Potential | ||||||
| Topological domain | 396 | 1 | Extracellular Potential | ||||||
| Transmembrane | 397 – 416 | 20 | Helical; Potential | ||||||
| Topological domain | 417 – 430 | 14 | Cytoplasmic Potential | ||||||
| Transmembrane | 431 – 451 | 21 | Helical; Potential | ||||||
| Topological domain | 452 – 463 | 12 | Extracellular Potential | ||||||
| Transmembrane | 464 – 484 | 21 | Helical; Potential | ||||||
| Topological domain | 485 – 500 | 16 | Cytoplasmic Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 350 – 500 | 151 | ITETV…RTTIK → KKNELSLIKVY in isoform 3. | VSP_042510 | |||||
| Alternative sequence | 451 – 500 | 50 | GWIYD…RTTIK → DVTHGWTTYLMHMKPLKT in isoform 2. | VSP_042511 | |||||
Experimental info | |||||||||
| Sequence conflict | 366 | 1 | N → D in BAC32495. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK045797 mRNA. Translation: BAC32495.1. AK049873 mRNA. Translation: BAC33967.1. AK052779 mRNA. Translation: BAC35143.1. AK085492 mRNA. Translation: BAC39456.1. AK136837 mRNA. Translation: BAE23142.1. AC132405 Genomic DNA. No translation available. CH466607 Genomic DNA. Translation: EDL01900.1. BC025441 mRNA. Translation: AAH25441.1. BC026596 mRNA. Translation: AAH26596.1. |
| IPI | IPI00453530. IPI00856269. |
| RefSeq | NP_666248.1. NM_146136.1. |
| UniGene | Mm.38384. |
3D structure databases | |
| ProteinModelPortal | Q8R0M8. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8R0M8. |
Proteomic databases | |
| PRIDE | Q8R0M8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000029502; ENSMUSP00000029502; ENSMUSG00000027896. ENSMUST00000106723; ENSMUSP00000102334; ENSMUSG00000027896. |
| GeneID | 229699. |
| KEGG | mmu:229699. |
| UCSC | uc008qwy.1. mouse. |
Organism-specific databases | |
| CTD | 9122. |
| MGI | MGI:2385183. Slc16a4. |
Phylogenomic databases | |
| GeneTree | ENSGT00680000099523. |
| HOGENOM | HOG000059591. |
| HOVERGEN | HBG006385. |
| InParanoid | Q8R0M8. |
| KO | K08181. |
| OMA | ISWSCKQ. |
Gene expression databases | |
| Bgee | Q8R0M8. |
| Genevestigator | Q8R0M8. |
Family and domain databases | |
| InterPro | IPR011701. MFS. IPR020846. MFS_dom. IPR016196. MFS_dom_general_subst_transpt. [Graphical view] |
| Pfam | PF07690. MFS_1. 1 hit. [Graphical view] |
| SUPFAM | SSF103473. MFS_gen_substrate_transporter. 1 hit. |
| PROSITE | PS50850. MFS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 379615. |
| SOURCE | Search... |
Entry information
| Entry name | MOT5_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8R0M8 Secondary accession number(s): Q8BLA5, Q8BWE3, Q8R157 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
