Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8R0C3

- S26A8_MOUSE

UniProt

Q8R0C3 - S26A8_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Testis anion transporter 1

Gene

Slc26a8

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

Acts as a DIDS-sensitive anion exchanger mediating chloride, sulfate and oxalate transport. May fulfill critical anion exchange functions in male germ line during meiosis and hence may play a role in spermatogenesis. May be involved in a new regulatory pathway linking sulfate transport to RhoGTPase signaling in male germ cells. A critical component of the sperm annulus that is essential for correct sperm tail differentiation and motility and hence male fertility. May form a moleculer complex involvrd in the regulation of chloride and bicarbonate ions fluxes during sperm capacitation (By similarity).By similarity

GO - Molecular functioni

  1. anion:anion antiporter activity Source: UniProtKB-KW
  2. chloride channel activity Source: Ensembl
  3. oxalate transmembrane transporter activity Source: Ensembl
  4. sulfate transmembrane transporter activity Source: Ensembl

GO - Biological processi

  1. cell differentiation Source: UniProtKB-KW
  2. meiotic nuclear division Source: UniProtKB-KW
  3. multicellular organismal development Source: UniProtKB-KW
  4. spermatogenesis Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Anion exchange, Differentiation, Ion transport, Meiosis, Spermatogenesis, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Testis anion transporter 1
Alternative name(s):
Anion exchange transporter
Solute carrier family 26 member 8
Gene namesi
Name:Slc26a8Imported
Synonyms:Tat11 Publication
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 17

Organism-specific databases

MGIiMGI:2385046. Slc26a8.

Subcellular locationi

Membrane 1 Publication; Multi-pass membrane protein 1 Publication
Note: Located at the annulus ring structure within the sperm cell.1 Publication

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Disruption phenotypei

Sperm lacks motility and displayed a capacitation defect, with reduced cAMP concentration due to misactivation of soluble adenylate cyclase (see Adcy1).1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 999999Testis anion transporter 1PRO_0000322588Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi190 – 1901N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

N-glycosylated.By similarity

Keywords - PTMi

Glycoprotein

Proteomic databases

PRIDEiQ8R0C3.

PTM databases

PhosphoSiteiQ8R0C3.

Expressioni

Tissue specificityi

Expressed in testis and epididymis. Located at the end of the midpiece of the flagella, known as the annulus, in spermatozoa.1 Publication

Gene expression databases

BgeeiQ8R0C3.
CleanExiMM_SLC26A8.
GenevestigatoriQ8R0C3.

Interactioni

Subunit structurei

Interacts with RACGAP1. Interacts with CFTR.By similarity

Protein-protein interaction databases

IntActiQ8R0C3. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ8R0C3.
SMRiQ8R0C3. Positions 714-800.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 9393CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini115 – 1173ExtracellularSequence Analysis
Topological domaini139 – 1391CytoplasmicSequence Analysis
Topological domaini161 – 20040ExtracellularSequence AnalysisAdd
BLAST
Topological domaini222 – 2309CytoplasmicSequence Analysis
Topological domaini252 – 26817ExtracellularSequence AnalysisAdd
BLAST
Topological domaini290 – 30516CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini327 – 35428ExtracellularSequence AnalysisAdd
BLAST
Topological domaini376 – 39015CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini412 – 42716ExtracellularSequence AnalysisAdd
BLAST
Topological domaini449 – 4535CytoplasmicSequence Analysis
Topological domaini475 – 49420ExtracellularSequence AnalysisAdd
BLAST
Topological domaini516 – 54429CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini566 – 999434ExtracellularSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei94 – 11421HelicalSequence AnalysisAdd
BLAST
Transmembranei118 – 13821HelicalSequence AnalysisAdd
BLAST
Transmembranei140 – 16021HelicalSequence AnalysisAdd
BLAST
Transmembranei201 – 22121HelicalSequence AnalysisAdd
BLAST
Transmembranei231 – 25121HelicalSequence AnalysisAdd
BLAST
Transmembranei269 – 28921HelicalSequence AnalysisAdd
BLAST
Transmembranei306 – 32621HelicalSequence AnalysisAdd
BLAST
Transmembranei355 – 37521HelicalSequence AnalysisAdd
BLAST
Transmembranei391 – 41121HelicalSequence AnalysisAdd
BLAST
Transmembranei428 – 44821HelicalSequence AnalysisAdd
BLAST
Transmembranei454 – 47421HelicalSequence AnalysisAdd
BLAST
Transmembranei495 – 51521HelicalSequence AnalysisAdd
BLAST
Transmembranei545 – 56521HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini541 – 796256STASPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni661 – 999339Interaction with RACGAP1By similarityAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi900 – 95253Glu-richSequence AnalysisAdd
BLAST

Sequence similaritiesi

Contains 1 STAS domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG0659.
GeneTreeiENSGT00760000119026.
HOGENOMiHOG000154234.
HOVERGENiHBG108443.
InParanoidiQ8R0C3.
KOiK14705.
OMAiIFGSCHQ.
OrthoDBiEOG73BVBX.
TreeFamiTF313784.

Family and domain databases

Gene3Di3.30.750.24. 2 hits.
InterProiIPR002645. STAS_dom.
IPR011547. Sulph_transpt.
[Graphical view]
PfamiPF01740. STAS. 1 hit.
PF00916. Sulfate_transp. 1 hit.
[Graphical view]
SUPFAMiSSF52091. SSF52091. 2 hits.
PROSITEiPS50801. STAS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8R0C3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQTERSLQSF SNRYTQIPFV YDVKRSVYNE ENFQQEHRKK GPTSGNVDID
60 70 80 90 100
ITTFKHHVQC GCSWHKFLRC MLTVFPFLEW ICLYRFKDWL LGDLLAGLSV
110 120 130 140 150
GLVQVPQGLI LSLLTRQLIP PLNVTYAAFC SSVIYVIFGS CHQMSIGPFF
160 170 180 190 200
LVSALMINVL KDRPFNNGHL ILGTFVKDDF SVPTFYLSYN RSLSMVASTT
210 220 230 240 250
FLTGIIQLSM GMLGMGFMAT YLPEAATSAY LAAVALHIIL AQMTCILGIM
260 270 280 290 300
VSFHAGPISF IYNIINYCIA LPKANSTSIL LFITSVVALR INKCIRITFN
310 320 330 340 350
RYPIEFPMEL LLILGFSLLT SKITMATENS KMLMNMIPYS FVFPENPEFG
360 370 380 390 400
ILSRVVLQAL SLSFVSSFLL ISLGKKIANF HNYRTNSNQD LIAIGLCNLL
410 420 430 440 450
SSFFKCCVFT GSLSRTTIQD KSGGRQQFAS LVGAGVMLLL MVKMESFFHN
460 470 480 490 500
LPNAVLAGII LSNVVPYLEA IYNLPSLWRQ DQYECIIWMV TFSSAILLGL
510 520 530 540 550
DVGLLISLAF TFFVITIRSH RTKILVLGQI PNTNIYRNVN DYREVILIPG
560 570 580 590 600
VKIFQCCSSI TFVNVYHLKQ KVLKEVNMVK LPLKEEEIYT LFHESETSIA
610 620 630 640 650
ENKLCRCFCD CEELEPEIRV VYTERYENRQ EQDSSINLIR CSYLGSGDSS
660 670 680 690 700
QVTSEEQIPY TVSSTSQRNI VQSYEDTEKA WLPNSPPRNS PLPPPEASES
710 720 730 740 750
LAQSRSRSII MPYSDTSVQN NTHTIILDFS MVHYVDNRAL VILRQMCNAF
760 770 780 790 800
YNANILVLIS GCHTSVVKSF EKNDFFDEGI TKAQLFLSLH DAVLFALSRK
810 820 830 840 850
FSEPSDLSMD ETETVIQETY SESDKNGNLS NLRLKTGKAI IEGSQHASPG
860 870 880 890 900
FTKNLKPGKD DLEFDLELDP MLSFEQSSGM DLNLDLDLDL DQSELDPGSE
910 920 930 940 950
LDSEIQAKPE LELESELETD AQTEPETEEE PELEPEPEPE PETEPEPEPE
960 970 980 990
RERKTRTRSQ SPWRNYFTAY RFGSSNSQSR APPQTRPEKR KPHNYPNSP

Note: Gene prediction based on similarity to human ortholog. No experimental confirmation available.Curated

Length:999
Mass (Da):112,978
Last modified:February 26, 2008 - v2
Checksum:i2664974E42D4996D
GO
Isoform 21 Publication (identifier: Q8R0C3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     486-521: IIWMVTFSSAILLGLDVGLLISLAFTFFVITIRSHR → VSTDASSGCNLGVRGAEAHTHTLPHGQFPGLDPWGQ
     522-999: Missing.

Note: Due to a partial intron retention. No experimental confirmation available.

Show »
Length:521
Mass (Da):58,127
Checksum:iE95BB4870BAEEDF6
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei486 – 52136IIWMV…IRSHR → VSTDASSGCNLGVRGAEAHT HTLPHGQFPGLDPWGQ in isoform 2. 1 PublicationVSP_052702Add
BLAST
Alternative sequencei522 – 999478Missing in isoform 2. 1 PublicationVSP_052703Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC170998 Genomic DNA. No translation available.
BC027076 mRNA. Translation: AAH27076.1. Sequence problems.
CCDSiCCDS70779.1. [Q8R0C3-1]
RefSeqiNP_001277249.1. NM_001290320.1. [Q8R0C3-1]
XP_006543427.1. XM_006543364.1. [Q8R0C3-1]
XP_006543428.1. XM_006543365.1. [Q8R0C3-1]

Genome annotation databases

EnsembliENSMUST00000114764; ENSMUSP00000110412; ENSMUSG00000036196. [Q8R0C3-1]
GeneIDi224661.
KEGGimmu:224661.
UCSCiuc008brk.1. mouse. [Q8R0C3-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AC170998 Genomic DNA. No translation available.
BC027076 mRNA. Translation: AAH27076.1 . Sequence problems.
CCDSi CCDS70779.1. [Q8R0C3-1 ]
RefSeqi NP_001277249.1. NM_001290320.1. [Q8R0C3-1 ]
XP_006543427.1. XM_006543364.1. [Q8R0C3-1 ]
XP_006543428.1. XM_006543365.1. [Q8R0C3-1 ]

3D structure databases

ProteinModelPortali Q8R0C3.
SMRi Q8R0C3. Positions 714-800.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q8R0C3. 1 interaction.

PTM databases

PhosphoSitei Q8R0C3.

Proteomic databases

PRIDEi Q8R0C3.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000114764 ; ENSMUSP00000110412 ; ENSMUSG00000036196 . [Q8R0C3-1 ]
GeneIDi 224661.
KEGGi mmu:224661.
UCSCi uc008brk.1. mouse. [Q8R0C3-2 ]

Organism-specific databases

CTDi 116369.
MGIi MGI:2385046. Slc26a8.

Phylogenomic databases

eggNOGi COG0659.
GeneTreei ENSGT00760000119026.
HOGENOMi HOG000154234.
HOVERGENi HBG108443.
InParanoidi Q8R0C3.
KOi K14705.
OMAi IFGSCHQ.
OrthoDBi EOG73BVBX.
TreeFami TF313784.

Miscellaneous databases

NextBioi 13882896.
PROi Q8R0C3.
SOURCEi Search...

Gene expression databases

Bgeei Q8R0C3.
CleanExi MM_SLC26A8.
Genevestigatori Q8R0C3.

Family and domain databases

Gene3Di 3.30.750.24. 2 hits.
InterProi IPR002645. STAS_dom.
IPR011547. Sulph_transpt.
[Graphical view ]
Pfami PF01740. STAS. 1 hit.
PF00916. Sulfate_transp. 1 hit.
[Graphical view ]
SUPFAMi SSF52091. SSF52091. 2 hits.
PROSITEi PS50801. STAS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Strain: C57BL/6J1 Publication.
    Tissue: RetinaImported.
  3. "The testis anion transporter 1 (Slc26a8) is required for sperm terminal differentiation and male fertility in the mouse."
    Toure A., Lhuillier P., Gossen J.A., Kuil C.W., Lhote D., Jegou B., Escalier D., Gacon G.
    Hum. Mol. Genet. 16:1783-1793(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  4. "The testis anion transporter TAT1 (SLC26A8) physically and functionally interacts with the cystic fibrosis transmembrane conductance regulator channel: a potential role during sperm capacitation."
    Rode B., Dirami T., Bakouh N., Rizk-Rabin M., Norez C., Lhuillier P., Lores P., Jollivet M., Melin P., Zvetkova I., Bienvenu T., Becq F., Planelles G., Edelman A., Gacon G., Toure A.
    Hum. Mol. Genet. 21:1287-1298(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: DISRUPTION PHENOTYPE.

Entry informationi

Entry nameiS26A8_MOUSE
AccessioniPrimary (citable) accession number: Q8R0C3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: October 29, 2014
This is version 86 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3