Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8R0C3 (S26A8_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 83. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Testis anion transporter 1
Alternative name(s):
Anion exchange transporter
Solute carrier family 26 member 8
Gene names
Name:Slc26a8
Synonyms:Tat1
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length999 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Acts as a DIDS-sensitive anion exchanger mediating chloride, sulfate and oxalate transport. May fulfill critical anion exchange functions in male germ line during meiosis and hence may play a role in spermatogenesis. May be involved in a new regulatory pathway linking sulfate transport to RhoGTPase signaling in male germ cells. A critical component of the sperm annulus that is essential for correct sperm tail differentiation and motility and hence male fertility. May form a moleculer complex involvrd in the regulation of chloride and bicarbonate ions fluxes during sperm capacitation By similarity. Ref.3 UniProtKB Q96RN1

Subunit structure

Interacts with RACGAP1 By similarity. Interacts with CFTR By similarity. UniProtKB Q96RN1

Subcellular location

Membrane; Multi-pass membrane protein. Note: Located at the annulus ring structure within the sperm cell. Ref.3

Tissue specificity

Expressed in testis and epididymis. Located at the end of the midpiece of the flagella, known as the annulus, in spermatozoa. Ref.3

Post-translational modification

N-glycosylated By similarity. UniProtKB Q96RN1

Disruption phenotype

Sperm lacks motility and displayed a capacitation defect, with reduced cAMP concentration due to misactivation of soluble adenylate cyclase (see Adcy1). Ref.4

Sequence similarities

Belongs to the SLC26A/SulP transporter (TC 2.A.53) family. [View classification]

Contains 1 STAS domain.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 Ref.3 (identifier: Q8R0C3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: Gene prediction based on similarity to human ortholog. No experimental confirmation available.
Isoform 2 Ref.2 (identifier: Q8R0C3-2)

The sequence of this isoform differs from the canonical sequence as follows:
     486-521: IIWMVTFSSAILLGLDVGLLISLAFTFFVITIRSHR → VSTDASSGCNLGVRGAEAHTHTLPHGQFPGLDPWGQ
     522-999: Missing.
Note: Due to a partial intron retention. No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 999999Testis anion transporter 1
PRO_0000322588

Regions

Topological domain1 – 9393Cytoplasmic Potential
Transmembrane94 – 11421Helical; Potential
Topological domain115 – 1173Extracellular Potential
Transmembrane118 – 13821Helical; Potential
Topological domain1391Cytoplasmic Potential
Transmembrane140 – 16021Helical; Potential
Topological domain161 – 20040Extracellular Potential
Transmembrane201 – 22121Helical; Potential
Topological domain222 – 2309Cytoplasmic Potential
Transmembrane231 – 25121Helical; Potential
Topological domain252 – 26817Extracellular Potential
Transmembrane269 – 28921Helical; Potential
Topological domain290 – 30516Cytoplasmic Potential
Transmembrane306 – 32621Helical; Potential
Topological domain327 – 35428Extracellular Potential
Transmembrane355 – 37521Helical; Potential
Topological domain376 – 39015Cytoplasmic Potential
Transmembrane391 – 41121Helical; Potential
Topological domain412 – 42716Extracellular Potential
Transmembrane428 – 44821Helical; Potential
Topological domain449 – 4535Cytoplasmic Potential
Transmembrane454 – 47421Helical; Potential
Topological domain475 – 49420Extracellular Potential
Transmembrane495 – 51521Helical; Potential
Topological domain516 – 54429Cytoplasmic Potential
Transmembrane545 – 56521Helical; Potential
Topological domain566 – 999434Extracellular Potential
Domain541 – 796256STAS
Region661 – 999339Interaction with RACGAP1 By similarity UniProtKB Q96RN1
Compositional bias900 – 95253Glu-rich

Amino acid modifications

Glycosylation1901N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence486 – 52136IIWMV…IRSHR → VSTDASSGCNLGVRGAEAHT HTLPHGQFPGLDPWGQ in isoform 2. Ref.2
VSP_052702
Alternative sequence522 – 999478Missing in isoform 2. Ref.2
VSP_052703

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 26, 2008. Version 2.
Checksum: 2664974E42D4996D

FASTA999112,978
        10         20         30         40         50         60 
MQTERSLQSF SNRYTQIPFV YDVKRSVYNE ENFQQEHRKK GPTSGNVDID ITTFKHHVQC 

        70         80         90        100        110        120 
GCSWHKFLRC MLTVFPFLEW ICLYRFKDWL LGDLLAGLSV GLVQVPQGLI LSLLTRQLIP 

       130        140        150        160        170        180 
PLNVTYAAFC SSVIYVIFGS CHQMSIGPFF LVSALMINVL KDRPFNNGHL ILGTFVKDDF 

       190        200        210        220        230        240 
SVPTFYLSYN RSLSMVASTT FLTGIIQLSM GMLGMGFMAT YLPEAATSAY LAAVALHIIL 

       250        260        270        280        290        300 
AQMTCILGIM VSFHAGPISF IYNIINYCIA LPKANSTSIL LFITSVVALR INKCIRITFN 

       310        320        330        340        350        360 
RYPIEFPMEL LLILGFSLLT SKITMATENS KMLMNMIPYS FVFPENPEFG ILSRVVLQAL 

       370        380        390        400        410        420 
SLSFVSSFLL ISLGKKIANF HNYRTNSNQD LIAIGLCNLL SSFFKCCVFT GSLSRTTIQD 

       430        440        450        460        470        480 
KSGGRQQFAS LVGAGVMLLL MVKMESFFHN LPNAVLAGII LSNVVPYLEA IYNLPSLWRQ 

       490        500        510        520        530        540 
DQYECIIWMV TFSSAILLGL DVGLLISLAF TFFVITIRSH RTKILVLGQI PNTNIYRNVN 

       550        560        570        580        590        600 
DYREVILIPG VKIFQCCSSI TFVNVYHLKQ KVLKEVNMVK LPLKEEEIYT LFHESETSIA 

       610        620        630        640        650        660 
ENKLCRCFCD CEELEPEIRV VYTERYENRQ EQDSSINLIR CSYLGSGDSS QVTSEEQIPY 

       670        680        690        700        710        720 
TVSSTSQRNI VQSYEDTEKA WLPNSPPRNS PLPPPEASES LAQSRSRSII MPYSDTSVQN 

       730        740        750        760        770        780 
NTHTIILDFS MVHYVDNRAL VILRQMCNAF YNANILVLIS GCHTSVVKSF EKNDFFDEGI 

       790        800        810        820        830        840 
TKAQLFLSLH DAVLFALSRK FSEPSDLSMD ETETVIQETY SESDKNGNLS NLRLKTGKAI 

       850        860        870        880        890        900 
IEGSQHASPG FTKNLKPGKD DLEFDLELDP MLSFEQSSGM DLNLDLDLDL DQSELDPGSE 

       910        920        930        940        950        960 
LDSEIQAKPE LELESELETD AQTEPETEEE PELEPEPEPE PETEPEPEPE RERKTRTRSQ 

       970        980        990 
SPWRNYFTAY RFGSSNSQSR APPQTRPEKR KPHNYPNSP 

« Hide

Isoform 2 [UniParc].

Checksum: E95BB4870BAEEDF6
Show »

FASTA52158,127

References

« Hide 'large scale' references
[1]"Lineage-specific biology revealed by a finished genome assembly of the mouse."
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. expand/collapse author list , Teague B., Potamousis K., Churas C., Place M., Herschleb J., Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z., Lindblad-Toh K., Eichler E.E., Ponting C.P.
PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Strain: C57BL/6J.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Strain: C57BL/6J.
Tissue: Retina.
[3]"The testis anion transporter 1 (Slc26a8) is required for sperm terminal differentiation and male fertility in the mouse."
Toure A., Lhuillier P., Gossen J.A., Kuil C.W., Lhote D., Jegou B., Escalier D., Gacon G.
Hum. Mol. Genet. 16:1783-1793(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[4]"The testis anion transporter TAT1 (SLC26A8) physically and functionally interacts with the cystic fibrosis transmembrane conductance regulator channel: a potential role during sperm capacitation."
Rode B., Dirami T., Bakouh N., Rizk-Rabin M., Norez C., Lhuillier P., Lores P., Jollivet M., Melin P., Zvetkova I., Bienvenu T., Becq F., Planelles G., Edelman A., Gacon G., Toure A.
Hum. Mol. Genet. 21:1287-1298(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: DISRUPTION PHENOTYPE.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AC170998 Genomic DNA. No translation available.
BC027076 mRNA. Translation: AAH27076.1. Sequence problems.
RefSeqNP_001277249.1. NM_001290320.1. [Q8R0C3-1]
XP_006543427.1. XM_006543364.1. [Q8R0C3-1]
XP_006543428.1. XM_006543365.1. [Q8R0C3-1]

3D structure databases

ProteinModelPortalQ8R0C3.
SMRQ8R0C3. Positions 714-800.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ8R0C3. 1 interaction.

PTM databases

PhosphoSiteQ8R0C3.

Proteomic databases

PRIDEQ8R0C3.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000114764; ENSMUSP00000110412; ENSMUSG00000036196. [Q8R0C3-1]
GeneID224661.
KEGGmmu:224661.
UCSCuc008brk.1. mouse. [Q8R0C3-2]

Organism-specific databases

CTD116369.
MGIMGI:2385046. Slc26a8.

Phylogenomic databases

eggNOGCOG0659.
GeneTreeENSGT00750000117294.
HOGENOMHOG000154234.
HOVERGENHBG108443.
InParanoidQ8R0C3.
KOK14705.
OMAIFGSCHQ.
OrthoDBEOG73BVBX.
TreeFamTF313784.

Gene expression databases

BgeeQ8R0C3.
CleanExMM_SLC26A8.
GenevestigatorQ8R0C3.

Family and domain databases

Gene3D3.30.750.24. 2 hits.
InterProIPR002645. STAS_dom.
IPR011547. Sulph_transpt.
[Graphical view]
PfamPF01740. STAS. 1 hit.
PF00916. Sulfate_transp. 1 hit.
[Graphical view]
SUPFAMSSF52091. SSF52091. 2 hits.
PROSITEPS50801. STAS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio13882896.
PROQ8R0C3.
SOURCESearch...

Entry information

Entry nameS26A8_MOUSE
AccessionPrimary (citable) accession number: Q8R0C3
Entry history
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: July 9, 2014
This is version 83 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot