Q8R0C3 (S26A8_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Testis anion transporter 1 Alternative name(s): Anion exchange transporter Solute carrier family 26 member 8 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 999 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Acts as a DIDS-sensitive anion exchanger mediating chloride, sulfate and oxalate transport. May fulfill critical anion exchange functions in male germ line during meiosis and hence may play a role in spermatogenesis. May be involved in a new regulatory pathway linking sulfate transport to RhoGTPase signaling in male germ cells. A critical component of the sperm annulus that is essential for correct sperm tail differentiation and motility and hence male fertility. Ref.3 UniProtKB Q96RN1 |
| Subunit structure | Interacts with RACGAP1 By similarity. UniProtKB Q96RN1 |
| Subcellular location | Membrane; Multi-pass membrane protein. Note: Located at the annulus ring structure within the sperm cell. Ref.3 |
| Tissue specificity | Expressed in testis and epididymis. Located at the end of the midpiece of the flagella, known as the annulus, in spermatozoa. Ref.3 |
| Post-translational modification | N-glycosylated By similarity. UniProtKB Q96RN1 |
| Sequence similarities | Belongs to the SLC26A/SulP transporter (TC 2.A.53) family. [View classification] Contains 1 STAS domain. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.3 (identifier: Q8R0C3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Gene prediction based on similarity to human ortholog. No experimental confirmation available. | ||||||
| Isoform 2 Ref.2 (identifier: Q8R0C3-2) The sequence of this isoform differs from the canonical sequence as follows: 486-521: IIWMVTFSSAILLGLDVGLLISLAFTFFVITIRSHR → VSTDASSGCNLGVRGAEAHTHTLPHGQFPGLDPWGQ 522-999: Missing. | ||||||
| Note: Due to a partial intron retention. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 999 | 999 | Testis anion transporter 1 | PRO_0000322588 | |||||
Regions | |||||||||
| Topological domain | 1 – 93 | 93 | Cytoplasmic Potential | ||||||
| Transmembrane | 94 – 114 | 21 | Helical; Potential | ||||||
| Topological domain | 115 – 117 | 3 | Extracellular Potential | ||||||
| Transmembrane | 118 – 138 | 21 | Helical; Potential | ||||||
| Topological domain | 139 | 1 | Cytoplasmic Potential | ||||||
| Transmembrane | 140 – 160 | 21 | Helical; Potential | ||||||
| Topological domain | 161 – 200 | 40 | Extracellular Potential | ||||||
| Transmembrane | 201 – 221 | 21 | Helical; Potential | ||||||
| Topological domain | 222 – 230 | 9 | Cytoplasmic Potential | ||||||
| Transmembrane | 231 – 251 | 21 | Helical; Potential | ||||||
| Topological domain | 252 – 268 | 17 | Extracellular Potential | ||||||
| Transmembrane | 269 – 289 | 21 | Helical; Potential | ||||||
| Topological domain | 290 – 305 | 16 | Cytoplasmic Potential | ||||||
| Transmembrane | 306 – 326 | 21 | Helical; Potential | ||||||
| Topological domain | 327 – 354 | 28 | Extracellular Potential | ||||||
| Transmembrane | 355 – 375 | 21 | Helical; Potential | ||||||
| Topological domain | 376 – 390 | 15 | Cytoplasmic Potential | ||||||
| Transmembrane | 391 – 411 | 21 | Helical; Potential | ||||||
| Topological domain | 412 – 427 | 16 | Extracellular Potential | ||||||
| Transmembrane | 428 – 448 | 21 | Helical; Potential | ||||||
| Topological domain | 449 – 453 | 5 | Cytoplasmic Potential | ||||||
| Transmembrane | 454 – 474 | 21 | Helical; Potential | ||||||
| Topological domain | 475 – 494 | 20 | Extracellular Potential | ||||||
| Transmembrane | 495 – 515 | 21 | Helical; Potential | ||||||
| Topological domain | 516 – 544 | 29 | Cytoplasmic Potential | ||||||
| Transmembrane | 545 – 565 | 21 | Helical; Potential | ||||||
| Topological domain | 566 – 999 | 434 | Extracellular Potential | ||||||
| Domain | 541 – 796 | 256 | STAS | ||||||
| Region | 661 – 999 | 339 | Interaction with RACGAP1 By similarity UniProtKB Q96RN1 | ||||||
| Compositional bias | 900 – 952 | 53 | Glu-rich | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 190 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 486 – 521 | 36 | IIWMV…IRSHR → VSTDASSGCNLGVRGAEAHT HTLPHGQFPGLDPWGQ in isoform 2. Ref.2 | VSP_052702 | |||||
| Alternative sequence | 522 – 999 | 478 | Missing in isoform 2. Ref.2 | VSP_052703 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Strain: C57BL/6J. Tissue: Retina. |
| [3] | "The testis anion transporter 1 (Slc26a8) is required for sperm terminal differentiation and male fertility in the mouse." Toure A., Lhuillier P., Gossen J.A., Kuil C.W., Lhote D., Jegou B., Escalier D., Gacon G. Hum. Mol. Genet. 16:1783-1793(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC170998 Genomic DNA. No translation available. BC027076 mRNA. Translation: AAH27076.1. Sequence problems. |
| IPI | IPI00153170. IPI00408861. |
| UniGene | Mm.219530. |
3D structure databases | |
| ProteinModelPortal | Q8R0C3. |
| SMR | Q8R0C3. Positions 714-800. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8R0C3. 1 interaction. |
PTM databases | |
| PhosphoSite | Q8R0C3. |
Proteomic databases | |
| PRIDE | Q8R0C3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000114764; ENSMUSP00000110412; ENSMUSG00000036196. |
| UCSC | uc008brk.1. mouse. |
Organism-specific databases | |
| MGI | MGI:2385046. Slc26a8. |
Phylogenomic databases | |
| eggNOG | COG0659. |
| GeneTree | ENSGT00650000092895. |
| HOGENOM | HOG000154234. |
| HOVERGEN | HBG108443. |
| InParanoid | Q8R0C3. |
| OMA | QLIPPLN. |
| OrthoDB | EOG495ZR3. |
Gene expression databases | |
| Bgee | Q8R0C3. |
| CleanEx | MM_SLC26A8. |
| Genevestigator | Q8R0C3. |
Family and domain databases | |
| Gene3D | 3.30.750.24. 2 hits. |
| InterPro | IPR002645. STAS_dom. IPR011547. Sulph_transpt. [Graphical view] |
| Pfam | PF01740. STAS. 1 hit. PF00916. Sulfate_transp. 1 hit. [Graphical view] |
| SUPFAM | SSF52091. STAS. 1 hit. |
| PROSITE | PS01130. SLC26A. False negative. PS50801. STAS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 13882896. |
| SOURCE | Search... |
Entry information
| Entry name | S26A8_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q8R0C3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
