Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8R0C3

- S26A8_MOUSE

UniProt

Q8R0C3 - S26A8_MOUSE

Protein

Testis anion transporter 1

Gene

Slc26a8

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 85 (01 Oct 2014)
      Sequence version 2 (26 Feb 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a DIDS-sensitive anion exchanger mediating chloride, sulfate and oxalate transport. May fulfill critical anion exchange functions in male germ line during meiosis and hence may play a role in spermatogenesis. May be involved in a new regulatory pathway linking sulfate transport to RhoGTPase signaling in male germ cells. A critical component of the sperm annulus that is essential for correct sperm tail differentiation and motility and hence male fertility. May form a moleculer complex involvrd in the regulation of chloride and bicarbonate ions fluxes during sperm capacitation By similarity.By similarity

    GO - Molecular functioni

    1. anion:anion antiporter activity Source: UniProtKB-KW
    2. chloride channel activity Source: Ensembl
    3. oxalate transmembrane transporter activity Source: Ensembl
    4. sulfate transmembrane transporter activity Source: Ensembl

    GO - Biological processi

    1. cell differentiation Source: UniProtKB-KW
    2. meiotic nuclear division Source: UniProtKB-KW
    3. multicellular organismal development Source: UniProtKB-KW
    4. spermatogenesis Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Anion exchange, Differentiation, Ion transport, Meiosis, Spermatogenesis, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Testis anion transporter 1
    Alternative name(s):
    Anion exchange transporter
    Solute carrier family 26 member 8
    Gene namesi
    Name:Slc26a8Imported
    Synonyms:Tat11 Publication
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 17

    Organism-specific databases

    MGIiMGI:2385046. Slc26a8.

    Subcellular locationi

    Membrane 1 Publication; Multi-pass membrane protein 1 Publication
    Note: Located at the annulus ring structure within the sperm cell.1 Publication

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: Ensembl

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Disruption phenotypei

    Sperm lacks motility and displayed a capacitation defect, with reduced cAMP concentration due to misactivation of soluble adenylate cyclase (see Adcy1).1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 999999Testis anion transporter 1PRO_0000322588Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi190 – 1901N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    N-glycosylated.By similarity

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PRIDEiQ8R0C3.

    PTM databases

    PhosphoSiteiQ8R0C3.

    Expressioni

    Tissue specificityi

    Expressed in testis and epididymis. Located at the end of the midpiece of the flagella, known as the annulus, in spermatozoa.1 Publication

    Gene expression databases

    BgeeiQ8R0C3.
    CleanExiMM_SLC26A8.
    GenevestigatoriQ8R0C3.

    Interactioni

    Subunit structurei

    Interacts with RACGAP1. Interacts with CFTR.By similarity

    Protein-protein interaction databases

    IntActiQ8R0C3. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8R0C3.
    SMRiQ8R0C3. Positions 714-800.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 9393CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini115 – 1173ExtracellularSequence Analysis
    Topological domaini139 – 1391CytoplasmicSequence Analysis
    Topological domaini161 – 20040ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini222 – 2309CytoplasmicSequence Analysis
    Topological domaini252 – 26817ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini290 – 30516CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini327 – 35428ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini376 – 39015CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini412 – 42716ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini449 – 4535CytoplasmicSequence Analysis
    Topological domaini475 – 49420ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini516 – 54429CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini566 – 999434ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei94 – 11421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei118 – 13821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei140 – 16021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei201 – 22121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei231 – 25121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei269 – 28921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei306 – 32621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei355 – 37521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei391 – 41121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei428 – 44821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei454 – 47421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei495 – 51521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei545 – 56521HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini541 – 796256STASPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni661 – 999339Interaction with RACGAP1By similarityAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi900 – 95253Glu-richSequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 STAS domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG0659.
    GeneTreeiENSGT00750000117294.
    HOGENOMiHOG000154234.
    HOVERGENiHBG108443.
    InParanoidiQ8R0C3.
    KOiK14705.
    OMAiIFGSCHQ.
    OrthoDBiEOG73BVBX.
    TreeFamiTF313784.

    Family and domain databases

    Gene3Di3.30.750.24. 2 hits.
    InterProiIPR002645. STAS_dom.
    IPR011547. Sulph_transpt.
    [Graphical view]
    PfamiPF01740. STAS. 1 hit.
    PF00916. Sulfate_transp. 1 hit.
    [Graphical view]
    SUPFAMiSSF52091. SSF52091. 2 hits.
    PROSITEiPS50801. STAS. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8R0C3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQTERSLQSF SNRYTQIPFV YDVKRSVYNE ENFQQEHRKK GPTSGNVDID    50
    ITTFKHHVQC GCSWHKFLRC MLTVFPFLEW ICLYRFKDWL LGDLLAGLSV 100
    GLVQVPQGLI LSLLTRQLIP PLNVTYAAFC SSVIYVIFGS CHQMSIGPFF 150
    LVSALMINVL KDRPFNNGHL ILGTFVKDDF SVPTFYLSYN RSLSMVASTT 200
    FLTGIIQLSM GMLGMGFMAT YLPEAATSAY LAAVALHIIL AQMTCILGIM 250
    VSFHAGPISF IYNIINYCIA LPKANSTSIL LFITSVVALR INKCIRITFN 300
    RYPIEFPMEL LLILGFSLLT SKITMATENS KMLMNMIPYS FVFPENPEFG 350
    ILSRVVLQAL SLSFVSSFLL ISLGKKIANF HNYRTNSNQD LIAIGLCNLL 400
    SSFFKCCVFT GSLSRTTIQD KSGGRQQFAS LVGAGVMLLL MVKMESFFHN 450
    LPNAVLAGII LSNVVPYLEA IYNLPSLWRQ DQYECIIWMV TFSSAILLGL 500
    DVGLLISLAF TFFVITIRSH RTKILVLGQI PNTNIYRNVN DYREVILIPG 550
    VKIFQCCSSI TFVNVYHLKQ KVLKEVNMVK LPLKEEEIYT LFHESETSIA 600
    ENKLCRCFCD CEELEPEIRV VYTERYENRQ EQDSSINLIR CSYLGSGDSS 650
    QVTSEEQIPY TVSSTSQRNI VQSYEDTEKA WLPNSPPRNS PLPPPEASES 700
    LAQSRSRSII MPYSDTSVQN NTHTIILDFS MVHYVDNRAL VILRQMCNAF 750
    YNANILVLIS GCHTSVVKSF EKNDFFDEGI TKAQLFLSLH DAVLFALSRK 800
    FSEPSDLSMD ETETVIQETY SESDKNGNLS NLRLKTGKAI IEGSQHASPG 850
    FTKNLKPGKD DLEFDLELDP MLSFEQSSGM DLNLDLDLDL DQSELDPGSE 900
    LDSEIQAKPE LELESELETD AQTEPETEEE PELEPEPEPE PETEPEPEPE 950
    RERKTRTRSQ SPWRNYFTAY RFGSSNSQSR APPQTRPEKR KPHNYPNSP 999

    Note: Gene prediction based on similarity to human ortholog. No experimental confirmation available.Curated

    Length:999
    Mass (Da):112,978
    Last modified:February 26, 2008 - v2
    Checksum:i2664974E42D4996D
    GO
    Isoform 21 Publication (identifier: Q8R0C3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         486-521: IIWMVTFSSAILLGLDVGLLISLAFTFFVITIRSHR → VSTDASSGCNLGVRGAEAHTHTLPHGQFPGLDPWGQ
         522-999: Missing.

    Note: Due to a partial intron retention. No experimental confirmation available.

    Show »
    Length:521
    Mass (Da):58,127
    Checksum:iE95BB4870BAEEDF6
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei486 – 52136IIWMV…IRSHR → VSTDASSGCNLGVRGAEAHT HTLPHGQFPGLDPWGQ in isoform 2. 1 PublicationVSP_052702Add
    BLAST
    Alternative sequencei522 – 999478Missing in isoform 2. 1 PublicationVSP_052703Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC170998 Genomic DNA. No translation available.
    BC027076 mRNA. Translation: AAH27076.1. Sequence problems.
    CCDSiCCDS70779.1. [Q8R0C3-1]
    RefSeqiNP_001277249.1. NM_001290320.1. [Q8R0C3-1]
    XP_006543427.1. XM_006543364.1. [Q8R0C3-1]
    XP_006543428.1. XM_006543365.1. [Q8R0C3-1]

    Genome annotation databases

    EnsembliENSMUST00000114764; ENSMUSP00000110412; ENSMUSG00000036196. [Q8R0C3-1]
    GeneIDi224661.
    KEGGimmu:224661.
    UCSCiuc008brk.1. mouse. [Q8R0C3-2]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AC170998 Genomic DNA. No translation available.
    BC027076 mRNA. Translation: AAH27076.1 . Sequence problems.
    CCDSi CCDS70779.1. [Q8R0C3-1 ]
    RefSeqi NP_001277249.1. NM_001290320.1. [Q8R0C3-1 ]
    XP_006543427.1. XM_006543364.1. [Q8R0C3-1 ]
    XP_006543428.1. XM_006543365.1. [Q8R0C3-1 ]

    3D structure databases

    ProteinModelPortali Q8R0C3.
    SMRi Q8R0C3. Positions 714-800.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q8R0C3. 1 interaction.

    PTM databases

    PhosphoSitei Q8R0C3.

    Proteomic databases

    PRIDEi Q8R0C3.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000114764 ; ENSMUSP00000110412 ; ENSMUSG00000036196 . [Q8R0C3-1 ]
    GeneIDi 224661.
    KEGGi mmu:224661.
    UCSCi uc008brk.1. mouse. [Q8R0C3-2 ]

    Organism-specific databases

    CTDi 116369.
    MGIi MGI:2385046. Slc26a8.

    Phylogenomic databases

    eggNOGi COG0659.
    GeneTreei ENSGT00750000117294.
    HOGENOMi HOG000154234.
    HOVERGENi HBG108443.
    InParanoidi Q8R0C3.
    KOi K14705.
    OMAi IFGSCHQ.
    OrthoDBi EOG73BVBX.
    TreeFami TF313784.

    Miscellaneous databases

    NextBioi 13882896.
    PROi Q8R0C3.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8R0C3.
    CleanExi MM_SLC26A8.
    Genevestigatori Q8R0C3.

    Family and domain databases

    Gene3Di 3.30.750.24. 2 hits.
    InterProi IPR002645. STAS_dom.
    IPR011547. Sulph_transpt.
    [Graphical view ]
    Pfami PF01740. STAS. 1 hit.
    PF00916. Sulfate_transp. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52091. SSF52091. 2 hits.
    PROSITEi PS50801. STAS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
      Strain: C57BL/6J.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Strain: C57BL/6J1 Publication.
      Tissue: RetinaImported.
    3. "The testis anion transporter 1 (Slc26a8) is required for sperm terminal differentiation and male fertility in the mouse."
      Toure A., Lhuillier P., Gossen J.A., Kuil C.W., Lhote D., Jegou B., Escalier D., Gacon G.
      Hum. Mol. Genet. 16:1783-1793(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    4. "The testis anion transporter TAT1 (SLC26A8) physically and functionally interacts with the cystic fibrosis transmembrane conductance regulator channel: a potential role during sperm capacitation."
      Rode B., Dirami T., Bakouh N., Rizk-Rabin M., Norez C., Lhuillier P., Lores P., Jollivet M., Melin P., Zvetkova I., Bienvenu T., Becq F., Planelles G., Edelman A., Gacon G., Toure A.
      Hum. Mol. Genet. 21:1287-1298(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: DISRUPTION PHENOTYPE.

    Entry informationi

    Entry nameiS26A8_MOUSE
    AccessioniPrimary (citable) accession number: Q8R0C3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 26, 2008
    Last sequence update: February 26, 2008
    Last modified: October 1, 2014
    This is version 85 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3