Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Testis anion transporter 1

Gene

Slc26a8

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Acts as a DIDS-sensitive anion exchanger mediating chloride, sulfate and oxalate transport. May fulfill critical anion exchange functions in male germ line during meiosis and hence may play a role in spermatogenesis. May be involved in a new regulatory pathway linking sulfate transport to RhoGTPase signaling in male germ cells. A critical component of the sperm annulus that is essential for correct sperm tail differentiation and motility and hence male fertility. May form a molecular complex involved in the regulation of chloride and bicarbonate ions fluxes during sperm capacitation (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Anion exchange, Differentiation, Ion transport, Meiosis, Spermatogenesis, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Testis anion transporter 1
Alternative name(s):
Anion exchange transporter
Solute carrier family 26 member 8
Gene namesi
Name:Slc26a8Imported
Synonyms:Tat11 Publication
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:2385046. Slc26a8.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 93CytoplasmicSequence analysisAdd BLAST93
Transmembranei94 – 114HelicalSequence analysisAdd BLAST21
Topological domaini115 – 117ExtracellularSequence analysis3
Transmembranei118 – 138HelicalSequence analysisAdd BLAST21
Topological domaini139CytoplasmicSequence analysis1
Transmembranei140 – 160HelicalSequence analysisAdd BLAST21
Topological domaini161 – 200ExtracellularSequence analysisAdd BLAST40
Transmembranei201 – 221HelicalSequence analysisAdd BLAST21
Topological domaini222 – 230CytoplasmicSequence analysis9
Transmembranei231 – 251HelicalSequence analysisAdd BLAST21
Topological domaini252 – 268ExtracellularSequence analysisAdd BLAST17
Transmembranei269 – 289HelicalSequence analysisAdd BLAST21
Topological domaini290 – 305CytoplasmicSequence analysisAdd BLAST16
Transmembranei306 – 326HelicalSequence analysisAdd BLAST21
Topological domaini327 – 354ExtracellularSequence analysisAdd BLAST28
Transmembranei355 – 375HelicalSequence analysisAdd BLAST21
Topological domaini376 – 390CytoplasmicSequence analysisAdd BLAST15
Transmembranei391 – 411HelicalSequence analysisAdd BLAST21
Topological domaini412 – 427ExtracellularSequence analysisAdd BLAST16
Transmembranei428 – 448HelicalSequence analysisAdd BLAST21
Topological domaini449 – 453CytoplasmicSequence analysis5
Transmembranei454 – 474HelicalSequence analysisAdd BLAST21
Topological domaini475 – 494ExtracellularSequence analysisAdd BLAST20
Transmembranei495 – 515HelicalSequence analysisAdd BLAST21
Topological domaini516 – 544CytoplasmicSequence analysisAdd BLAST29
Transmembranei545 – 565HelicalSequence analysisAdd BLAST21
Topological domaini566 – 999ExtracellularSequence analysisAdd BLAST434

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Disruption phenotypei

Sperm lacks motility and displayed a capacitation defect, with reduced cAMP concentration due to misactivation of soluble adenylate cyclase (see Adcy1).1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003225881 – 999Testis anion transporter 1Add BLAST999

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi190N-linked (GlcNAc...)Sequence analysis1

Post-translational modificationi

N-glycosylated.By similarity

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ8R0C3.
PRIDEiQ8R0C3.

PTM databases

iPTMnetiQ8R0C3.
PhosphoSitePlusiQ8R0C3.

Expressioni

Tissue specificityi

Expressed in testis and epididymis. Located at the end of the midpiece of the flagella, known as the annulus, in spermatozoa.1 Publication

Gene expression databases

BgeeiENSMUSG00000036196.
CleanExiMM_SLC26A8.
GenevisibleiQ8R0C3. MM.

Interactioni

Subunit structurei

Interacts with RACGAP1. Interacts with CFTR.By similarity

Protein-protein interaction databases

IntActiQ8R0C3. 1 interactor.
STRINGi10090.ENSMUSP00000110412.

Structurei

3D structure databases

ProteinModelPortaliQ8R0C3.
SMRiQ8R0C3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini541 – 796STASPROSITE-ProRule annotationAdd BLAST256

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni661 – 999Interaction with RACGAP1By similarityAdd BLAST339

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi900 – 952Glu-richSequence analysisAdd BLAST53

Sequence similaritiesi

Contains 1 STAS domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0236. Eukaryota.
COG0659. LUCA.
GeneTreeiENSGT00760000119026.
HOGENOMiHOG000154234.
HOVERGENiHBG108443.
InParanoidiQ8R0C3.
KOiK14705.
OMAiFGSCHQM.
OrthoDBiEOG091G025O.
TreeFamiTF313784.

Family and domain databases

Gene3Di3.30.750.24. 2 hits.
InterProiIPR011547. SLC26A/SulP_dom.
IPR001902. SLC26A/SulP_fam.
IPR030303. SLC26A8.
IPR002645. STAS_dom.
[Graphical view]
PANTHERiPTHR11814. PTHR11814. 3 hits.
PTHR11814:SF11. PTHR11814:SF11. 3 hits.
PfamiPF01740. STAS. 1 hit.
PF00916. Sulfate_transp. 1 hit.
[Graphical view]
SUPFAMiSSF52091. SSF52091. 2 hits.
PROSITEiPS50801. STAS. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8R0C3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQTERSLQSF SNRYTQIPFV YDVKRSVYNE ENFQQEHRKK GPTSGNVDID
60 70 80 90 100
ITTFKHHVQC GCSWHKFLRC MLTVFPFLEW ICLYRFKDWL LGDLLAGLSV
110 120 130 140 150
GLVQVPQGLI LSLLTRQLIP PLNVTYAAFC SSVIYVIFGS CHQMSIGPFF
160 170 180 190 200
LVSALMINVL KDRPFNNGHL ILGTFVKDDF SVPTFYLSYN RSLSMVASTT
210 220 230 240 250
FLTGIIQLSM GMLGMGFMAT YLPEAATSAY LAAVALHIIL AQMTCILGIM
260 270 280 290 300
VSFHAGPISF IYNIINYCIA LPKANSTSIL LFITSVVALR INKCIRITFN
310 320 330 340 350
RYPIEFPMEL LLILGFSLLT SKITMATENS KMLMNMIPYS FVFPENPEFG
360 370 380 390 400
ILSRVVLQAL SLSFVSSFLL ISLGKKIANF HNYRTNSNQD LIAIGLCNLL
410 420 430 440 450
SSFFKCCVFT GSLSRTTIQD KSGGRQQFAS LVGAGVMLLL MVKMESFFHN
460 470 480 490 500
LPNAVLAGII LSNVVPYLEA IYNLPSLWRQ DQYECIIWMV TFSSAILLGL
510 520 530 540 550
DVGLLISLAF TFFVITIRSH RTKILVLGQI PNTNIYRNVN DYREVILIPG
560 570 580 590 600
VKIFQCCSSI TFVNVYHLKQ KVLKEVNMVK LPLKEEEIYT LFHESETSIA
610 620 630 640 650
ENKLCRCFCD CEELEPEIRV VYTERYENRQ EQDSSINLIR CSYLGSGDSS
660 670 680 690 700
QVTSEEQIPY TVSSTSQRNI VQSYEDTEKA WLPNSPPRNS PLPPPEASES
710 720 730 740 750
LAQSRSRSII MPYSDTSVQN NTHTIILDFS MVHYVDNRAL VILRQMCNAF
760 770 780 790 800
YNANILVLIS GCHTSVVKSF EKNDFFDEGI TKAQLFLSLH DAVLFALSRK
810 820 830 840 850
FSEPSDLSMD ETETVIQETY SESDKNGNLS NLRLKTGKAI IEGSQHASPG
860 870 880 890 900
FTKNLKPGKD DLEFDLELDP MLSFEQSSGM DLNLDLDLDL DQSELDPGSE
910 920 930 940 950
LDSEIQAKPE LELESELETD AQTEPETEEE PELEPEPEPE PETEPEPEPE
960 970 980 990
RERKTRTRSQ SPWRNYFTAY RFGSSNSQSR APPQTRPEKR KPHNYPNSP
Note: Gene prediction based on similarity to human ortholog. No experimental confirmation available.Curated
Length:999
Mass (Da):112,978
Last modified:February 26, 2008 - v2
Checksum:i2664974E42D4996D
GO
Isoform 21 Publication (identifier: Q8R0C3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     486-521: IIWMVTFSSAILLGLDVGLLISLAFTFFVITIRSHR → VSTDASSGCNLGVRGAEAHTHTLPHGQFPGLDPWGQ
     522-999: Missing.

Note: Due to a partial intron retention. No experimental confirmation available.
Show »
Length:521
Mass (Da):58,127
Checksum:iE95BB4870BAEEDF6
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_052702486 – 521IIWMV…IRSHR → VSTDASSGCNLGVRGAEAHT HTLPHGQFPGLDPWGQ in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_052703522 – 999Missing in isoform 2. 1 PublicationAdd BLAST478

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC170998 Genomic DNA. No translation available.
BC027076 mRNA. Translation: AAH27076.1. Sequence problems.
CCDSiCCDS70779.1. [Q8R0C3-1]
RefSeqiNP_001277249.1. NM_001290320.1. [Q8R0C3-1]

Genome annotation databases

EnsembliENSMUST00000114764; ENSMUSP00000110412; ENSMUSG00000036196. [Q8R0C3-1]
GeneIDi224661.
KEGGimmu:224661.
UCSCiuc008brk.1. mouse. [Q8R0C3-2]
uc056zdz.1. mouse. [Q8R0C3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC170998 Genomic DNA. No translation available.
BC027076 mRNA. Translation: AAH27076.1. Sequence problems.
CCDSiCCDS70779.1. [Q8R0C3-1]
RefSeqiNP_001277249.1. NM_001290320.1. [Q8R0C3-1]

3D structure databases

ProteinModelPortaliQ8R0C3.
SMRiQ8R0C3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8R0C3. 1 interactor.
STRINGi10090.ENSMUSP00000110412.

PTM databases

iPTMnetiQ8R0C3.
PhosphoSitePlusiQ8R0C3.

Proteomic databases

PaxDbiQ8R0C3.
PRIDEiQ8R0C3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000114764; ENSMUSP00000110412; ENSMUSG00000036196. [Q8R0C3-1]
GeneIDi224661.
KEGGimmu:224661.
UCSCiuc008brk.1. mouse. [Q8R0C3-2]
uc056zdz.1. mouse. [Q8R0C3-1]

Organism-specific databases

CTDi116369.
MGIiMGI:2385046. Slc26a8.

Phylogenomic databases

eggNOGiKOG0236. Eukaryota.
COG0659. LUCA.
GeneTreeiENSGT00760000119026.
HOGENOMiHOG000154234.
HOVERGENiHBG108443.
InParanoidiQ8R0C3.
KOiK14705.
OMAiFGSCHQM.
OrthoDBiEOG091G025O.
TreeFamiTF313784.

Miscellaneous databases

PROiQ8R0C3.
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000036196.
CleanExiMM_SLC26A8.
GenevisibleiQ8R0C3. MM.

Family and domain databases

Gene3Di3.30.750.24. 2 hits.
InterProiIPR011547. SLC26A/SulP_dom.
IPR001902. SLC26A/SulP_fam.
IPR030303. SLC26A8.
IPR002645. STAS_dom.
[Graphical view]
PANTHERiPTHR11814. PTHR11814. 3 hits.
PTHR11814:SF11. PTHR11814:SF11. 3 hits.
PfamiPF01740. STAS. 1 hit.
PF00916. Sulfate_transp. 1 hit.
[Graphical view]
SUPFAMiSSF52091. SSF52091. 2 hits.
PROSITEiPS50801. STAS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiS26A8_MOUSE
AccessioniPrimary (citable) accession number: Q8R0C3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: November 2, 2016
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.