Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Microtubule-associated protein RP/EB family member 2

Gene

Mapre2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Names & Taxonomyi

Protein namesi
Recommended name:
Microtubule-associated protein RP/EB family member 2
Alternative name(s):
APC-binding protein EB2
End-binding protein 2
Short name:
EB2
Gene namesi
Name:Mapre2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:106271. Mapre2.

Subcellular locationi

  • Cytoplasm By similarity
  • Cytoplasmcytoskeleton By similarity

  • Note: Associated with the microtubule network. Accumulates at the plus end of microtubules (By similarity).By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Microtubule

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 326326Microtubule-associated protein RP/EB family member 2PRO_0000213425Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei9 – 91PhosphoserineBy similarity
Modified residuei166 – 1661PhosphotyrosineCombined sources
Modified residuei218 – 2181PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8R001.
MaxQBiQ8R001.
PaxDbiQ8R001.
PeptideAtlasiQ8R001.
PRIDEiQ8R001.

PTM databases

iPTMnetiQ8R001.
PhosphoSiteiQ8R001.

Expressioni

Gene expression databases

BgeeiQ8R001.
ExpressionAtlasiQ8R001. baseline and differential.
GenevisibleiQ8R001. MM.

Interactioni

Subunit structurei

Interacts with DCTN1. Binds to the C-terminal domain of APC. Binds monomeric and polymerized tubulin (By similarity).By similarity

Protein-protein interaction databases

BioGridi229310. 2 interactions.
IntActiQ8R001. 3 interactions.
MINTiMINT-4101245.
STRINGi10090.ENSMUSP00000025127.

Structurei

3D structure databases

ProteinModelPortaliQ8R001.
SMRiQ8R001. Positions 43-172, 221-301.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini56 – 158103CHPROSITE-ProRule annotationAdd
BLAST
Domaini235 – 30571EB1 C-terminalPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni186 – 326141DCTN1-bindingBy similarityAdd
BLAST
Regioni258 – 30144APC-bindingBy similarityAdd
BLAST

Domaini

Composed of two functionally independent domains. The N-terminal domain forms a hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1 (By similarity).By similarity

Sequence similaritiesi

Belongs to the MAPRE family.Curated
Contains 1 CH (calponin-homology) domain.PROSITE-ProRule annotation
Contains 1 EB1 C-terminal domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG3000. Eukaryota.
COG5217. LUCA.
GeneTreeiENSGT00490000043329.
HOGENOMiHOG000198048.
HOVERGENiHBG052410.
InParanoidiQ8R001.
KOiK10436.
OMAiHESHTEE.
PhylomeDBiQ8R001.
TreeFamiTF313620.

Family and domain databases

Gene3Di1.10.418.10. 1 hit.
InterProiIPR001715. CH-domain.
IPR004953. EB1_C.
IPR027328. MAPRE.
IPR027735. RP1/EB2_vertebrate.
[Graphical view]
PANTHERiPTHR10623. PTHR10623. 1 hit.
PTHR10623:SF7. PTHR10623:SF7. 1 hit.
PfamiPF00307. CH. 1 hit.
PF03271. EB1. 1 hit.
[Graphical view]
SUPFAMiSSF140612. SSF140612. 1 hit.
SSF47576. SSF47576. 1 hit.
PROSITEiPS50021. CH. 1 hit.
PS51230. EB1_C. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8R001-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPGPTQTLSP NGENNNDIIQ DNGTIIPFRK HTVRGERSYS WGMAVNVYST
60 70 80 90 100
SITQETMSRH DIIAWVNDIV SLNYTKVEQL CSGAAYCQFM DMLFPGCISL
110 120 130 140 150
KKVKFQAKLE HEYIHNFKLL QASFKRMNVD KVIPVEKLVK GRFQDNLDFI
160 170 180 190 200
QWFKKFYDAN YDGKEYDPVE ARQGQDAIPP PDPGEQIFNL PKKSHHANSP
210 220 230 240 250
TAGAAKSSPA SKPGSTPSRP SSAKRASSSG SASRSDKDLE TQVIQLNEQV
260 270 280 290 300
HSLKLALEGV EKERDFYFGK LREIELLCQE HGQENDDLVQ RLMEVLYASD
310 320
EQEGQTEEPE AEEQAHDQQP QQQEEY
Length:326
Mass (Da):36,946
Last modified:June 1, 2002 - v1
Checksum:i51C0916F37075651
GO
Isoform 2 (identifier: Q8R001-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MPGPTQTLSPNGENNNDIIQDNGTIIPFRKHTVRGERSYS → MKQIRDQRVIRKGPQKHHSLQQPGRVPGCSN

Note: No experimental confirmation available.
Show »
Length:317
Mass (Da):36,070
Checksum:iE59C01FA3E06845E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti103 – 1031V → E in BAC30045 (PubMed:16141072).Curated
Sequence conflicti251 – 2511H → Y in AAH35254 (PubMed:15489334).Curated
Sequence conflicti251 – 2511H → Y in AAH28987 (PubMed:15489334).Curated
Sequence conflicti319 – 3191Q → H in BAC30700 (PubMed:16141072).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4040MPGPT…ERSYS → MKQIRDQRVIRKGPQKHHSL QQPGRVPGCSN in isoform 2. 1 PublicationVSP_012946Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028823 mRNA. Translation: BAC26138.1.
AK038562 mRNA. Translation: BAC30045.1.
AK040767 mRNA. Translation: BAC30700.1.
AK045493 mRNA. Translation: BAC32393.1.
AK045904 mRNA. Translation: BAE43326.1.
AK046221 mRNA. Translation: BAC32643.1.
AK148954 mRNA. Translation: BAE28700.1.
BC025804 mRNA. Translation: AAH25804.1.
BC027056 mRNA. Translation: AAH27056.1.
BC028987 mRNA. Translation: AAH28987.1.
BC035254 mRNA. Translation: AAH35254.1.
CCDSiCCDS29095.1. [Q8R001-1]
CCDS50237.1. [Q8R001-2]
RefSeqiNP_001156413.1. NM_001162941.1. [Q8R001-2]
NP_001156414.1. NM_001162942.1.
NP_694698.3. NM_153058.4. [Q8R001-1]
UniGeneiMm.132237.

Genome annotation databases

EnsembliENSMUST00000025127; ENSMUSP00000025127; ENSMUSG00000024277. [Q8R001-1]
ENSMUST00000115830; ENSMUSP00000111496; ENSMUSG00000024277. [Q8R001-2]
GeneIDi212307.
KEGGimmu:212307.
UCSCiuc008ege.2. mouse. [Q8R001-2]
uc008egf.2. mouse. [Q8R001-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK028823 mRNA. Translation: BAC26138.1.
AK038562 mRNA. Translation: BAC30045.1.
AK040767 mRNA. Translation: BAC30700.1.
AK045493 mRNA. Translation: BAC32393.1.
AK045904 mRNA. Translation: BAE43326.1.
AK046221 mRNA. Translation: BAC32643.1.
AK148954 mRNA. Translation: BAE28700.1.
BC025804 mRNA. Translation: AAH25804.1.
BC027056 mRNA. Translation: AAH27056.1.
BC028987 mRNA. Translation: AAH28987.1.
BC035254 mRNA. Translation: AAH35254.1.
CCDSiCCDS29095.1. [Q8R001-1]
CCDS50237.1. [Q8R001-2]
RefSeqiNP_001156413.1. NM_001162941.1. [Q8R001-2]
NP_001156414.1. NM_001162942.1.
NP_694698.3. NM_153058.4. [Q8R001-1]
UniGeneiMm.132237.

3D structure databases

ProteinModelPortaliQ8R001.
SMRiQ8R001. Positions 43-172, 221-301.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi229310. 2 interactions.
IntActiQ8R001. 3 interactions.
MINTiMINT-4101245.
STRINGi10090.ENSMUSP00000025127.

PTM databases

iPTMnetiQ8R001.
PhosphoSiteiQ8R001.

Proteomic databases

EPDiQ8R001.
MaxQBiQ8R001.
PaxDbiQ8R001.
PeptideAtlasiQ8R001.
PRIDEiQ8R001.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000025127; ENSMUSP00000025127; ENSMUSG00000024277. [Q8R001-1]
ENSMUST00000115830; ENSMUSP00000111496; ENSMUSG00000024277. [Q8R001-2]
GeneIDi212307.
KEGGimmu:212307.
UCSCiuc008ege.2. mouse. [Q8R001-2]
uc008egf.2. mouse. [Q8R001-1]

Organism-specific databases

CTDi10982.
MGIiMGI:106271. Mapre2.

Phylogenomic databases

eggNOGiKOG3000. Eukaryota.
COG5217. LUCA.
GeneTreeiENSGT00490000043329.
HOGENOMiHOG000198048.
HOVERGENiHBG052410.
InParanoidiQ8R001.
KOiK10436.
OMAiHESHTEE.
PhylomeDBiQ8R001.
TreeFamiTF313620.

Miscellaneous databases

ChiTaRSiMapre2. mouse.
PROiQ8R001.
SOURCEiSearch...

Gene expression databases

BgeeiQ8R001.
ExpressionAtlasiQ8R001. baseline and differential.
GenevisibleiQ8R001. MM.

Family and domain databases

Gene3Di1.10.418.10. 1 hit.
InterProiIPR001715. CH-domain.
IPR004953. EB1_C.
IPR027328. MAPRE.
IPR027735. RP1/EB2_vertebrate.
[Graphical view]
PANTHERiPTHR10623. PTHR10623. 1 hit.
PTHR10623:SF7. PTHR10623:SF7. 1 hit.
PfamiPF00307. CH. 1 hit.
PF03271. EB1. 1 hit.
[Graphical view]
SUPFAMiSSF140612. SSF140612. 1 hit.
SSF47576. SSF47576. 1 hit.
PROSITEiPS50021. CH. 1 hit.
PS51230. EB1_C. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J.
    Tissue: Aorta, Corpora quadrigemina, Hypothalamus, Skin, Sympathetic ganglion and Vein.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: FVB/N.
    Tissue: Eye and Liver.
  3. "Quantitative time-resolved phosphoproteomic analysis of mast cell signaling."
    Cao L., Yu K., Banh C., Nguyen V., Ritz A., Raphael B.J., Kawakami Y., Kawakami T., Salomon A.R.
    J. Immunol. 179:5864-5876(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-166, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Mast cell.
  4. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiMARE2_MOUSE
AccessioniPrimary (citable) accession number: Q8R001
Secondary accession number(s): Q3UF61
, Q8BLZ6, Q8BYR6, Q8C177, Q8K109
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 2005
Last sequence update: June 1, 2002
Last modified: July 6, 2016
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.