Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcriptional repressor CTCFL

Gene

CTCFL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Testis-specific DNA binding protein responsible for insulator function, nuclear architecture and transcriptional control, which probably acts by recruiting epigenetic chromatin modifiers. Plays a key role in gene imprinting in male germline, by participating in the establishment of differential methylation at the IGF2/H19 imprinted control region (ICR). Directly binds the unmethylated H19 ICR and recruits the PRMT7 methyltransferase, leading to methylate histone H4 'Arg-3' to form H4R3sme2. This probably leads to recruit de novo DNA methyltransferases at these sites (By similarity). Seems to act as tumor suppressor. In association with DNMT1 and DNMT3B, involved in activation of BAG1 gene expression by binding to its promoter. Required for dimethylation of H3 lysine 4 (H3K4me2) of MYC and BRCA1 promoters.By similarity3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri257 – 279C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri285 – 307C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri313 – 336C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri342 – 364C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri370 – 392C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri398 – 421C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri428 – 451C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri458 – 480C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri486 – 508C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri514 – 537C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri546 – 568C2H2-type 11; atypicalPROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

  • cell cycle Source: UniProtKB-KW
  • DNA methylation involved in gamete generation Source: UniProtKB
  • histone methylation Source: UniProtKB
  • positive regulation of gene expression Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • positive regulation of transcription from RNA polymerase II promoter Source: NTNU_SB
  • regulation of gene expression by genetic imprinting Source: UniProtKB
  • regulation of histone H3-K4 methylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Activator, Chromatin regulator, Repressor

Keywords - Biological processi

Cell cycle, Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000124092-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcriptional repressor CTCFL
Alternative name(s):
Brother of the regulator of imprinted sites
CCCTC-binding factor
CTCF paralog
CTCF-like protein
Cancer/testis antigen 27
Short name:
CT27
Zinc finger protein CTCF-T
Gene namesi
Name:CTCFL
Synonyms:BORIS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:16234. CTCFL.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi140690.
OpenTargetsiENSG00000124092.
PharmGKBiPA26999.

Polymorphism and mutation databases

BioMutaiCTCFL.
DMDMi313104098.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000472261 – 663Transcriptional repressor CTCFLAdd BLAST663

Proteomic databases

EPDiQ8NI51.
MaxQBiQ8NI51.
PaxDbiQ8NI51.
PeptideAtlasiQ8NI51.
PRIDEiQ8NI51.

PTM databases

iPTMnetiQ8NI51.
PhosphoSitePlusiQ8NI51.

Expressioni

Tissue specificityi

Testis specific. Specifically expressed in primary spermatocytes.

Developmental stagei

Is up-regulated in primary spermatocytes (expression overlapping with the genome-wide erasure of methylation) to become silenced on activation of CTCF in post-meiotic germline cells (expression corresponding to DNA remethylation).

Gene expression databases

BgeeiENSG00000124092.
CleanExiHS_CTCFL.
ExpressionAtlasiQ8NI51. baseline and differential.
GenevisibleiQ8NI51. HS.

Organism-specific databases

HPAiHPA001472.

Interactioni

Subunit structurei

Interacts with histones, PRMT7 and SETD1A. Interacts (via N-terminus) with BAG6/BAT3.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi126653. 9 interactors.
IntActiQ8NI51. 15 interactors.
STRINGi9606.ENSP00000243914.

Structurei

3D structure databases

ProteinModelPortaliQ8NI51.
SMRiQ8NI51.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CTCF zinc-finger protein family.Curated
Contains 11 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri257 – 279C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri285 – 307C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri313 – 336C2H2-type 3PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri342 – 364C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri370 – 392C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri398 – 421C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri428 – 451C2H2-type 7PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri458 – 480C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri486 – 508C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri514 – 537C2H2-type 10PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri546 – 568C2H2-type 11; atypicalPROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063079.
HOGENOMiHOG000276534.
InParanoidiQ8NI51.
OMAiASFHERY.
OrthoDBiEOG091G06B4.
PhylomeDBiQ8NI51.
TreeFamiTF106430.

Family and domain databases

Gene3Di3.30.160.60. 10 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 11 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 7 hits.
PS50157. ZINC_FINGER_C2H2_2. 11 hits.
[Graphical view]

Sequences (11)i

Sequence statusi: Complete.

This entry describes 11 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NI51-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAATEISVLS EQFTKIKELE LMPEKGLKEE EKDGVCREKD HRSPSELEAE
60 70 80 90 100
RTSGAFQDSV LEEEVELVLA PSEESEKYIL TLQTVHFTSE AVELQDMSLL
110 120 130 140 150
SIQQQEGVQV VVQQPGPGLL WLEEGPRQSL QQCVAISIQQ ELYSPQEMEV
160 170 180 190 200
LQFHALEENV MVASEDSKLA VSLAETTGLI KLEEEQEKNQ LLAERTKEQL
210 220 230 240 250
FFVETMSGDE RSDEIVLTVS NSNVEEQEDQ PTAGQADAEK AKSTKNQRKT
260 270 280 290 300
KGAKGTFHCD VCMFTSSRMS SFNRHMKTHT SEKPHLCHLC LKTFRTVTLL
310 320 330 340 350
RNHVNTHTGT RPYKCNDCNM AFVTSGELVR HRRYKHTHEK PFKCSMCKYA
360 370 380 390 400
SVEASKLKRH VRSHTGERPF QCCQCSYASR DTYKLKRHMR THSGEKPYEC
410 420 430 440 450
HICHTRFTQS GTMKIHILQK HGENVPKYQC PHCATIIARK SDLRVHMRNL
460 470 480 490 500
HAYSAAELKC RYCSAVFHER YALIQHQKTH KNEKRFKCKH CSYACKQERH
510 520 530 540 550
MTAHIRTHTG EKPFTCLSCN KCFRQKQLLN AHFRKYHDAN FIPTVYKCSK
560 570 580 590 600
CGKGFSRWIN LHRHSEKCGS GEAKSAASGK GRRTRKRKQT ILKEATKGQK
610 620 630 640 650
EAAKGWKEAA NGDEAAAEEA STTKGEQFPG EMFPVACRET TARVKEEVDE
660
GVTCEMLLNT MDK
Length:663
Mass (Da):75,747
Last modified:November 30, 2010 - v2
Checksum:i9351E1A85173D085
GO
Isoform 2 (identifier: Q8NI51-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     560-663: NLHRHSEKCG...CEMLLNTMDK → TSKWSGLKPQTFIT

Show »
Length:573
Mass (Da):66,029
Checksum:i79DFEA839B95D94B
GO
Isoform 3 (identifier: Q8NI51-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS

Show »
Length:665
Mass (Da):75,836
Checksum:i322DE1AF4BD6328E
GO
Isoform 4 (identifier: Q8NI51-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     354-497: Missing.
     560-663: NLHRHSEKCG...CEMLLNTMDK → LWVGNSEVAE...LLQGPLCRAA

Show »
Length:483
Mass (Da):54,194
Checksum:iAA920F461EC5A901
GO
Isoform 5 (identifier: Q8NI51-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.
     560-663: NLHRHSEKCG...CEMLLNTMDK → LWVGNSEVAE...LLQGPLCRAA

Show »
Length:422
Mass (Da):48,088
Checksum:i363AC9455A24D686
GO
Isoform 6 (identifier: Q8NI51-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS

Show »
Length:403
Mass (Da):46,538
Checksum:i141E4AFDF4B5BC2E
GO
Isoform 7 (identifier: Q8NI51-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     663-663: K → NSAGCTGRMMLVSAWLLGRPQETYNQGRRRRGSRRVTW

Show »
Length:700
Mass (Da):80,010
Checksum:iC5ECEB4A1EFA816F
GO
Isoform 8 (identifier: Q8NI51-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     395-444: Missing.

Show »
Length:613
Mass (Da):69,916
Checksum:i4192478A258CB6A1
GO
Isoform 9 (identifier: Q8NI51-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     394-427: GEKPYECHICHTRFTQSGTMKIHILQKHGENVPK → EATSKRSLQEIPRCKFHPDCLQMLQVWQRLFPLD
     428-663: Missing.

Show »
Length:427
Mass (Da):48,929
Checksum:iAF3D08C4C3250FAA
GO
Isoform 10 (identifier: Q8NI51-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS

Show »
Length:460
Mass (Da):52,690
Checksum:i55F8D2CC9872A225
GO
Isoform 11 (identifier: Q8NI51-11) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     559-663: INLHRHSEKC...CEMLLNTMDK → VLY

Show »
Length:299
Mass (Da):35,417
Checksum:i15FF2AEC96221604
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti613Missing in AAL61541 (PubMed:17048991).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02321350E → Q.Corresponds to variant rs6070128dbSNPEnsembl.1
Natural variantiVAR_023214177T → A.4 PublicationsCorresponds to variant rs6025606dbSNPEnsembl.1
Natural variantiVAR_057374448R → H.Corresponds to variant rs6092491dbSNPEnsembl.1
Natural variantiVAR_032766525Q → E.Corresponds to variant rs6070122dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0451551 – 262Missing in isoform 6 and isoform 11. 1 PublicationAdd BLAST262
Alternative sequenceiVSP_0451561 – 205Missing in isoform 5 and isoform 10. 1 PublicationAdd BLAST205
Alternative sequenceiVSP_045157354 – 497Missing in isoform 4. 1 PublicationAdd BLAST144
Alternative sequenceiVSP_047725394 – 427GEKPY…ENVPK → EATSKRSLQEIPRCKFHPDC LQMLQVWQRLFPLD in isoform 9. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_047058395 – 444Missing in isoform 8. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_047726428 – 663Missing in isoform 9. 1 PublicationAdd BLAST236
Alternative sequenceiVSP_054899559 – 663INLHR…NTMDK → VLY in isoform 11. 1 PublicationAdd BLAST105
Alternative sequenceiVSP_045158560 – 663NLHRH…NTMDK → TSKWSGLKPQTFIT in isoform 2. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_045159560 – 663NLHRH…NTMDK → LWVGNSEVAELGGPGSGPLL RLQSGCPPGLHHPKAGLGPE DPLPGQLRHTTAGTGLSSLL QGPLCRAA in isoform 4 and isoform 5. 1 PublicationAdd BLAST104
Alternative sequenceiVSP_045160614 – 663EAAAE…NTMDK → GVISAHRNLCLLGSSDSHAS VSGAGITDARHHAWLIVLLF LVEMGFYHVSHS in isoform 3, isoform 6 and isoform 10. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_047059663K → NSAGCTGRMMLVSAWLLGRP QETYNQGRRRRGSRRVTW in isoform 7. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF336042 mRNA. Translation: AAM28645.1.
AY071919 mRNA. Translation: AAL61541.1.
DQ294738 mRNA. Translation: ABB92839.1.
DQ778124 mRNA. Translation: ABH10106.1.
DQ778108 mRNA. Translation: ABH10090.1.
DQ778109 mRNA. Translation: ABH10091.1.
DQ778110 mRNA. Translation: ABH10092.1.
DQ778111 mRNA. Translation: ABH10093.1.
DQ778112 mRNA. Translation: ABH10094.1.
DQ778115 mRNA. Translation: ABH10097.1.
DQ778116 mRNA. Translation: ABH10098.1.
DQ778121 mRNA. Translation: ABH10103.2.
DQ778123 mRNA. Translation: ABH10105.1.
DQ778125 mRNA. Translation: ABH10107.2.
DQ778126 mRNA. Translation: ABH10108.1.
DQ778127 mRNA. Translation: ABH10109.1.
AK128070 mRNA. Translation: BAG54626.1.
AL035541 Genomic DNA. No translation available.
AL160176 Genomic DNA. Translation: CAI42956.1.
CH471077 Genomic DNA. Translation: EAW75518.1.
BC130486 mRNA. Translation: AAI30487.1.
CCDSiCCDS13459.1. [Q8NI51-1]
CCDS58776.1. [Q8NI51-6]
CCDS58777.1. [Q8NI51-5]
CCDS58778.1. [Q8NI51-4]
CCDS58779.1. [Q8NI51-8]
CCDS58780.1. [Q8NI51-7]
CCDS58781.1. [Q8NI51-3]
CCDS58782.1. [Q8NI51-2]
CCDS68161.1. [Q8NI51-11]
CCDS68162.1. [Q8NI51-10]
RefSeqiNP_001255969.1. NM_001269040.1. [Q8NI51-1]
NP_001255970.1. NM_001269041.1. [Q8NI51-1]
NP_001255971.1. NM_001269042.1.
NP_001255972.1. NM_001269043.1. [Q8NI51-7]
NP_001255973.1. NM_001269044.1. [Q8NI51-3]
NP_001255974.1. NM_001269045.1.
NP_001255975.1. NM_001269046.1. [Q8NI51-8]
NP_001255976.1. NM_001269047.1. [Q8NI51-2]
NP_001255977.1. NM_001269048.1. [Q8NI51-4]
NP_001255978.1. NM_001269049.1. [Q8NI51-10]
NP_001255979.1. NM_001269050.1. [Q8NI51-5]
NP_001255980.1. NM_001269051.1.
NP_001255981.1. NM_001269052.1.
NP_001255983.1. NM_001269054.1. [Q8NI51-6]
NP_001255984.1. NM_001269055.1. [Q8NI51-11]
NP_542185.2. NM_080618.3. [Q8NI51-1]
UniGeneiHs.131543.

Genome annotation databases

EnsembliENST00000243914; ENSP00000243914; ENSG00000124092. [Q8NI51-1]
ENST00000371196; ENSP00000360239; ENSG00000124092. [Q8NI51-1]
ENST00000422109; ENSP00000413713; ENSG00000124092. [Q8NI51-9]
ENST00000422869; ENSP00000399061; ENSG00000124092. [Q8NI51-2]
ENST00000423479; ENSP00000415579; ENSG00000124092. [Q8NI51-7]
ENST00000429804; ENSP00000415329; ENSG00000124092. [Q8NI51-8]
ENST00000432255; ENSP00000409344; ENSG00000124092. [Q8NI51-4]
ENST00000433949; ENSP00000392034; ENSG00000124092. [Q8NI51-10]
ENST00000502686; ENSP00000437999; ENSG00000124092. [Q8NI51-6]
ENST00000539382; ENSP00000439998; ENSG00000124092. [Q8NI51-5]
ENST00000608263; ENSP00000476783; ENSG00000124092. [Q8NI51-1]
ENST00000608440; ENSP00000477488; ENSG00000124092. [Q8NI51-3]
ENST00000608903; ENSP00000476718; ENSG00000124092. [Q8NI51-11]
ENST00000609232; ENSP00000476398; ENSG00000124092. [Q8NI51-1]
GeneIDi140690.
KEGGihsa:140690.
UCSCiuc010giw.2. human. [Q8NI51-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF336042 mRNA. Translation: AAM28645.1.
AY071919 mRNA. Translation: AAL61541.1.
DQ294738 mRNA. Translation: ABB92839.1.
DQ778124 mRNA. Translation: ABH10106.1.
DQ778108 mRNA. Translation: ABH10090.1.
DQ778109 mRNA. Translation: ABH10091.1.
DQ778110 mRNA. Translation: ABH10092.1.
DQ778111 mRNA. Translation: ABH10093.1.
DQ778112 mRNA. Translation: ABH10094.1.
DQ778115 mRNA. Translation: ABH10097.1.
DQ778116 mRNA. Translation: ABH10098.1.
DQ778121 mRNA. Translation: ABH10103.2.
DQ778123 mRNA. Translation: ABH10105.1.
DQ778125 mRNA. Translation: ABH10107.2.
DQ778126 mRNA. Translation: ABH10108.1.
DQ778127 mRNA. Translation: ABH10109.1.
AK128070 mRNA. Translation: BAG54626.1.
AL035541 Genomic DNA. No translation available.
AL160176 Genomic DNA. Translation: CAI42956.1.
CH471077 Genomic DNA. Translation: EAW75518.1.
BC130486 mRNA. Translation: AAI30487.1.
CCDSiCCDS13459.1. [Q8NI51-1]
CCDS58776.1. [Q8NI51-6]
CCDS58777.1. [Q8NI51-5]
CCDS58778.1. [Q8NI51-4]
CCDS58779.1. [Q8NI51-8]
CCDS58780.1. [Q8NI51-7]
CCDS58781.1. [Q8NI51-3]
CCDS58782.1. [Q8NI51-2]
CCDS68161.1. [Q8NI51-11]
CCDS68162.1. [Q8NI51-10]
RefSeqiNP_001255969.1. NM_001269040.1. [Q8NI51-1]
NP_001255970.1. NM_001269041.1. [Q8NI51-1]
NP_001255971.1. NM_001269042.1.
NP_001255972.1. NM_001269043.1. [Q8NI51-7]
NP_001255973.1. NM_001269044.1. [Q8NI51-3]
NP_001255974.1. NM_001269045.1.
NP_001255975.1. NM_001269046.1. [Q8NI51-8]
NP_001255976.1. NM_001269047.1. [Q8NI51-2]
NP_001255977.1. NM_001269048.1. [Q8NI51-4]
NP_001255978.1. NM_001269049.1. [Q8NI51-10]
NP_001255979.1. NM_001269050.1. [Q8NI51-5]
NP_001255980.1. NM_001269051.1.
NP_001255981.1. NM_001269052.1.
NP_001255983.1. NM_001269054.1. [Q8NI51-6]
NP_001255984.1. NM_001269055.1. [Q8NI51-11]
NP_542185.2. NM_080618.3. [Q8NI51-1]
UniGeneiHs.131543.

3D structure databases

ProteinModelPortaliQ8NI51.
SMRiQ8NI51.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126653. 9 interactors.
IntActiQ8NI51. 15 interactors.
STRINGi9606.ENSP00000243914.

PTM databases

iPTMnetiQ8NI51.
PhosphoSitePlusiQ8NI51.

Polymorphism and mutation databases

BioMutaiCTCFL.
DMDMi313104098.

Proteomic databases

EPDiQ8NI51.
MaxQBiQ8NI51.
PaxDbiQ8NI51.
PeptideAtlasiQ8NI51.
PRIDEiQ8NI51.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000243914; ENSP00000243914; ENSG00000124092. [Q8NI51-1]
ENST00000371196; ENSP00000360239; ENSG00000124092. [Q8NI51-1]
ENST00000422109; ENSP00000413713; ENSG00000124092. [Q8NI51-9]
ENST00000422869; ENSP00000399061; ENSG00000124092. [Q8NI51-2]
ENST00000423479; ENSP00000415579; ENSG00000124092. [Q8NI51-7]
ENST00000429804; ENSP00000415329; ENSG00000124092. [Q8NI51-8]
ENST00000432255; ENSP00000409344; ENSG00000124092. [Q8NI51-4]
ENST00000433949; ENSP00000392034; ENSG00000124092. [Q8NI51-10]
ENST00000502686; ENSP00000437999; ENSG00000124092. [Q8NI51-6]
ENST00000539382; ENSP00000439998; ENSG00000124092. [Q8NI51-5]
ENST00000608263; ENSP00000476783; ENSG00000124092. [Q8NI51-1]
ENST00000608440; ENSP00000477488; ENSG00000124092. [Q8NI51-3]
ENST00000608903; ENSP00000476718; ENSG00000124092. [Q8NI51-11]
ENST00000609232; ENSP00000476398; ENSG00000124092. [Q8NI51-1]
GeneIDi140690.
KEGGihsa:140690.
UCSCiuc010giw.2. human. [Q8NI51-1]

Organism-specific databases

CTDi140690.
DisGeNETi140690.
GeneCardsiCTCFL.
HGNCiHGNC:16234. CTCFL.
HPAiHPA001472.
MIMi607022. gene.
neXtProtiNX_Q8NI51.
OpenTargetsiENSG00000124092.
PharmGKBiPA26999.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063079.
HOGENOMiHOG000276534.
InParanoidiQ8NI51.
OMAiASFHERY.
OrthoDBiEOG091G06B4.
PhylomeDBiQ8NI51.
TreeFamiTF106430.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000124092-MONOMER.

Miscellaneous databases

GeneWikiiCTCFL.
GenomeRNAii140690.
PROiQ8NI51.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000124092.
CleanExiHS_CTCFL.
ExpressionAtlasiQ8NI51. baseline and differential.
GenevisibleiQ8NI51. HS.

Family and domain databases

Gene3Di3.30.160.60. 10 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 11 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 7 hits.
PS50157. ZINC_FINGER_C2H2_2. 11 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCTCFL_HUMAN
AccessioniPrimary (citable) accession number: Q8NI51
Secondary accession number(s): A0S6W1
, A1L4C6, A6XGL8, A6XGM2, A6XGM3, A6XGM8, A6XGN0, A6XGN1, A6XGN2, A6XGN3, A6XGN4, E7EQ27, E7EUE3, E9PBA9, Q5JUG4, Q9BZ30, Q9NQJ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: November 30, 2010
Last modified: November 2, 2016
This is version 137 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.