Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NI51 (CTCFL_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 118. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Transcriptional repressor CTCFL
Alternative name(s):
Brother of the regulator of imprinted sites
CCCTC-binding factor
CTCF paralog
CTCF-like protein
Cancer/testis antigen 27
Short name=CT27
Zinc finger protein CTCF-T
Gene names
Name:CTCFL
Synonyms:BORIS
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length663 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Testis-specific DNA binding protein responsible for insulator function, nuclear architecture and transcriptional control, which probably acts by recruiting epigenetic chromatin modifiers. Plays a key role in gene imprinting in male germline, by participating in the establishment of differential methylation at the IGF2/H19 imprinted control region (ICR). Directly binds the unmethylated H19 ICR and recruits the PRMT7 methyltransferase, leading to methylate histone H4 'Arg-3' to form H4R3sme2. This probably leads to recruit de novo DNA methyltransferases at these sites By similarity. Seems to act as tumor suppressor. In association with DNMT1 and DNMT3B, involved in activation of BAG1 gene expression by binding to its promoter. Required for dimethylation of H3 lysine 4 (H3K4me2) of MYC and BRCA1 promoters. Ref.1 Ref.9 Ref.10

Subunit structure

Interacts with histones, PRMT7 and SETD1A. Interacts (via N-terminus) with BAG6/BAT3. Ref.10

Subcellular location

Cytoplasm. Nucleus.

Tissue specificity

Testis specific. Specifically expressed in primary spermatocytes.

Developmental stage

Is up-regulated in primary spermatocytes (expression overlapping with the genome-wide erasure of methylation) to become silenced on activation of CTCF in post-meiotic germline cells (expression corresponding to DNA remethylation).

Sequence similarities

Belongs to the CTCF zinc-finger protein family.

Contains 11 C2H2-type zinc fingers.

Ontologies

Keywords
   Biological processCell cycle
Transcription
Transcription regulation
   Cellular componentCytoplasm
Nucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainRepeat
Zinc-finger
   LigandDNA-binding
Metal-binding
Zinc
   Molecular functionActivator
Chromatin regulator
Repressor
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processDNA methylation involved in gamete generation

Inferred from sequence or structural similarity. Source: UniProtKB

cell cycle

Inferred from electronic annotation. Source: UniProtKB-KW

histone methylation

Inferred from sequence or structural similarity. Source: UniProtKB

positive regulation of gene expression

Inferred from direct assay Ref.9. Source: UniProtKB

positive regulation of transcription, DNA-templated

Inferred from direct assay Ref.9. Source: UniProtKB

regulation of gene expression by genetic imprinting

Inferred from sequence or structural similarity. Source: UniProtKB

regulation of histone H3-K4 methylation

Inferred from mutant phenotype Ref.10. Source: UniProtKB

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

nucleus

Inferred from sequence or structural similarity. Source: UniProtKB

   Molecular_functionDNA binding

Inferred from direct assay Ref.9. Source: UniProtKB

histone binding

Inferred from sequence or structural similarity. Source: UniProtKB

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

protein binding

Inferred from physical interaction Ref.10. Source: UniProtKB

sequence-specific DNA binding

Inferred from sequence or structural similarity. Source: UniProtKB

transcription regulatory region DNA binding

Inferred from direct assay Ref.9. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 11 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8NI51-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8NI51-2)

The sequence of this isoform differs from the canonical sequence as follows:
     560-663: NLHRHSEKCG...CEMLLNTMDK → TSKWSGLKPQTFIT
Isoform 3 (identifier: Q8NI51-3)

The sequence of this isoform differs from the canonical sequence as follows:
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS
Isoform 4 (identifier: Q8NI51-4)

The sequence of this isoform differs from the canonical sequence as follows:
     354-497: Missing.
     560-663: NLHRHSEKCG...CEMLLNTMDK → LWVGNSEVAE...LLQGPLCRAA
Isoform 5 (identifier: Q8NI51-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.
     560-663: NLHRHSEKCG...CEMLLNTMDK → LWVGNSEVAE...LLQGPLCRAA
Isoform 6 (identifier: Q8NI51-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS
Isoform 7 (identifier: Q8NI51-7)

The sequence of this isoform differs from the canonical sequence as follows:
     663-663: K → NSAGCTGRMMLVSAWLLGRPQETYNQGRRRRGSRRVTW
Isoform 8 (identifier: Q8NI51-8)

The sequence of this isoform differs from the canonical sequence as follows:
     395-444: Missing.
Isoform 9 (identifier: Q8NI51-9)

The sequence of this isoform differs from the canonical sequence as follows:
     394-427: GEKPYECHICHTRFTQSGTMKIHILQKHGENVPK → EATSKRSLQEIPRCKFHPDCLQMLQVWQRLFPLD
     428-663: Missing.
Isoform 10 (identifier: Q8NI51-10)

The sequence of this isoform differs from the canonical sequence as follows:
     1-205: Missing.
     614-663: EAAAEEASTT...CEMLLNTMDK → GVISAHRNLC...EMGFYHVSHS
Isoform 11 (identifier: Q8NI51-11)

The sequence of this isoform differs from the canonical sequence as follows:
     1-262: Missing.
     559-663: INLHRHSEKC...CEMLLNTMDK → VLY

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 663663Transcriptional repressor CTCFL
PRO_0000047226

Regions

Zinc finger257 – 27923C2H2-type 1
Zinc finger285 – 30723C2H2-type 2
Zinc finger313 – 33624C2H2-type 3
Zinc finger342 – 36423C2H2-type 4
Zinc finger370 – 39223C2H2-type 5
Zinc finger398 – 42124C2H2-type 6
Zinc finger428 – 45124C2H2-type 7
Zinc finger458 – 48023C2H2-type 8
Zinc finger486 – 50823C2H2-type 9
Zinc finger514 – 53724C2H2-type 10
Zinc finger546 – 56823C2H2-type 11; atypical

Natural variations

Alternative sequence1 – 262262Missing in isoform 6 and isoform 11.
VSP_045155
Alternative sequence1 – 205205Missing in isoform 5 and isoform 10.
VSP_045156
Alternative sequence354 – 497144Missing in isoform 4.
VSP_045157
Alternative sequence394 – 42734GEKPY…ENVPK → EATSKRSLQEIPRCKFHPDC LQMLQVWQRLFPLD in isoform 9.
VSP_047725
Alternative sequence395 – 44450Missing in isoform 8.
VSP_047058
Alternative sequence428 – 663236Missing in isoform 9.
VSP_047726
Alternative sequence559 – 663105INLHR…NTMDK → VLY in isoform 11.
VSP_054899
Alternative sequence560 – 663104NLHRH…NTMDK → TSKWSGLKPQTFIT in isoform 2.
VSP_045158
Alternative sequence560 – 663104NLHRH…NTMDK → LWVGNSEVAELGGPGSGPLL RLQSGCPPGLHHPKAGLGPE DPLPGQLRHTTAGTGLSSLL QGPLCRAA in isoform 4 and isoform 5.
VSP_045159
Alternative sequence614 – 66350EAAAE…NTMDK → GVISAHRNLCLLGSSDSHAS VSGAGITDARHHAWLIVLLF LVEMGFYHVSHS in isoform 3, isoform 6 and isoform 10.
VSP_045160
Alternative sequence6631K → NSAGCTGRMMLVSAWLLGRP QETYNQGRRRRGSRRVTW in isoform 7.
VSP_047059
Natural variant501E → Q.
Corresponds to variant rs6070128 [ dbSNP | Ensembl ].
VAR_023213
Natural variant1771T → A. Ref.1 Ref.3 Ref.4 Ref.7
Corresponds to variant rs6025606 [ dbSNP | Ensembl ].
VAR_023214
Natural variant4481R → H.
Corresponds to variant rs6092491 [ dbSNP | Ensembl ].
VAR_057374
Natural variant5251Q → E.
Corresponds to variant rs6070122 [ dbSNP | Ensembl ].
VAR_032766

Experimental info

Sequence conflict6131Missing in AAL61541. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 30, 2010. Version 2.
Checksum: 9351E1A85173D085

FASTA66375,747
        10         20         30         40         50         60 
MAATEISVLS EQFTKIKELE LMPEKGLKEE EKDGVCREKD HRSPSELEAE RTSGAFQDSV 

        70         80         90        100        110        120 
LEEEVELVLA PSEESEKYIL TLQTVHFTSE AVELQDMSLL SIQQQEGVQV VVQQPGPGLL 

       130        140        150        160        170        180 
WLEEGPRQSL QQCVAISIQQ ELYSPQEMEV LQFHALEENV MVASEDSKLA VSLAETTGLI 

       190        200        210        220        230        240 
KLEEEQEKNQ LLAERTKEQL FFVETMSGDE RSDEIVLTVS NSNVEEQEDQ PTAGQADAEK 

       250        260        270        280        290        300 
AKSTKNQRKT KGAKGTFHCD VCMFTSSRMS SFNRHMKTHT SEKPHLCHLC LKTFRTVTLL 

       310        320        330        340        350        360 
RNHVNTHTGT RPYKCNDCNM AFVTSGELVR HRRYKHTHEK PFKCSMCKYA SVEASKLKRH 

       370        380        390        400        410        420 
VRSHTGERPF QCCQCSYASR DTYKLKRHMR THSGEKPYEC HICHTRFTQS GTMKIHILQK 

       430        440        450        460        470        480 
HGENVPKYQC PHCATIIARK SDLRVHMRNL HAYSAAELKC RYCSAVFHER YALIQHQKTH 

       490        500        510        520        530        540 
KNEKRFKCKH CSYACKQERH MTAHIRTHTG EKPFTCLSCN KCFRQKQLLN AHFRKYHDAN 

       550        560        570        580        590        600 
FIPTVYKCSK CGKGFSRWIN LHRHSEKCGS GEAKSAASGK GRRTRKRKQT ILKEATKGQK 

       610        620        630        640        650        660 
EAAKGWKEAA NGDEAAAEEA STTKGEQFPG EMFPVACRET TARVKEEVDE GVTCEMLLNT 


MDK 

« Hide

Isoform 2 [UniParc].

Checksum: 79DFEA839B95D94B
Show »

FASTA57366,029
Isoform 3 [UniParc].

Checksum: 322DE1AF4BD6328E
Show »

FASTA66575,836
Isoform 4 [UniParc].

Checksum: AA920F461EC5A901
Show »

FASTA48354,194
Isoform 5 [UniParc].

Checksum: 363AC9455A24D686
Show »

FASTA42248,088
Isoform 6 [UniParc].

Checksum: 141E4AFDF4B5BC2E
Show »

FASTA40346,538
Isoform 7 [UniParc].

Checksum: C5ECEB4A1EFA816F
Show »

FASTA70080,010
Isoform 8 [UniParc].

Checksum: 4192478A258CB6A1
Show »

FASTA61369,916
Isoform 9 [UniParc].

Checksum: AF3D08C4C3250FAA
Show »

FASTA42748,929
Isoform 10 [UniParc].

Checksum: 55F8D2CC9872A225
Show »

FASTA46052,690
Isoform 11 [UniParc].

Checksum: 15FF2AEC96221604
Show »

FASTA29935,417

References

« Hide 'large scale' references
[1]"BORIS, a novel male germ-line-specific protein associated with epigenetic reprogramming events, shares the same 11-zinc-finger domain with CTCF, the insulator protein involved in reading imprinting marks in the soma."
Loukinov D.I., Pugacheva E., Vatolin S., Pack S.D., Moon H., Chernukhin I., Mannan P., Larsson E., Kanduri C., Vostrov A.A., Cui H., Niemitz E.L., Rasko J.E.J., Docquier F.M., Kistler M., Breen J.J., Zhuang Z., Quitschke W.W. expand/collapse author list , Renkawitz R., Klenova E.M., Feinberg A.P., Ohlsson R., Morse H.C. III, Lobanenkov V.V.
Proc. Natl. Acad. Sci. U.S.A. 99:6806-6811(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10 AND 11), FUNCTION, VARIANT ALA-177.
Tissue: Testis.
[2]"The testis-specific factor CTCFL cooperates with the protein methyltransferase PRMT7 in H19 imprinting control region methylation."
Jelinic P., Stehle J.-C., Shaw P.
PLoS Biol. 4:E355-E355(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Testis.
[3]"Expression of the CTCF-paralogous cancer-testis gene, brother of the regulator of imprinted sites (BORIS), is regulated by three alternative promoters modulated by CpG methylation and by CTCF and p53 transcription factors."
Renaud S., Pugacheva E.M., Delgado M.D., Braunschweig R., Abdullaev Z., Loukinov D., Benhattar J., Lobanenkov V.
Nucleic Acids Res. 35:7372-7388(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ALA-177.
Tissue: Testis.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ALA-177.
Tissue: Testis.
[5]"The DNA sequence and comparative analysis of human chromosome 20."
Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. expand/collapse author list , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ALA-177.
[8]"The novel BORIS + CTCF gene family is uniquely involved in the epigenetics of normal biology and cancer."
Klenova E.M., Morse H.C. III, Ohlsson R., Lobanenkov V.V.
Semin. Cancer Biol. 12:399-414(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: REVIEW.
[9]"DNA methyltransferase 1 and 3B activate BAG-1 expression via recruitment of CTCFL/BORIS and modulation of promoter histone methylation."
Sun L., Huang L., Nguyen P., Bisht K.S., Bar-Sela G., Ho A.S., Bradbury C.M., Yu W., Cui H., Lee S., Trepel J.B., Feinberg A.P., Gius D.
Cancer Res. 68:2726-2735(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[10]"BAT3 and SET1A form a complex with CTCFL/BORIS to modulate H3K4 histone dimethylation and gene expression."
Nguyen P., Bar-Sela G., Sun L., Bisht K.S., Cui H., Kohn E., Feinberg A.P., Gius D.
Mol. Cell. Biol. 28:6720-6729(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH BAG6/BAT3 AND SETD1A.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF336042 mRNA. Translation: AAM28645.1.
AY071919 mRNA. Translation: AAL61541.1.
DQ294738 mRNA. Translation: ABB92839.1.
DQ778124 mRNA. Translation: ABH10106.1.
DQ778108 mRNA. Translation: ABH10090.1.
DQ778109 mRNA. Translation: ABH10091.1.
DQ778110 mRNA. Translation: ABH10092.1.
DQ778111 mRNA. Translation: ABH10093.1.
DQ778112 mRNA. Translation: ABH10094.1.
DQ778115 mRNA. Translation: ABH10097.1.
DQ778116 mRNA. Translation: ABH10098.1.
DQ778121 mRNA. Translation: ABH10103.2.
DQ778123 mRNA. Translation: ABH10105.1.
DQ778125 mRNA. Translation: ABH10107.2.
DQ778126 mRNA. Translation: ABH10108.1.
DQ778127 mRNA. Translation: ABH10109.1.
AK128070 mRNA. Translation: BAG54626.1.
AL035541 Genomic DNA. No translation available.
AL160176 Genomic DNA. Translation: CAI42956.1.
CH471077 Genomic DNA. Translation: EAW75518.1.
BC130486 mRNA. Translation: AAI30487.1.
CCDSCCDS13459.1. [Q8NI51-1]
CCDS58776.1. [Q8NI51-6]
CCDS58777.1. [Q8NI51-5]
CCDS58778.1. [Q8NI51-4]
CCDS58779.1. [Q8NI51-8]
CCDS58780.1. [Q8NI51-7]
CCDS58781.1. [Q8NI51-3]
CCDS58782.1. [Q8NI51-2]
RefSeqNP_001255969.1. NM_001269040.1. [Q8NI51-1]
NP_001255970.1. NM_001269041.1. [Q8NI51-1]
NP_001255971.1. NM_001269042.1.
NP_001255972.1. NM_001269043.1. [Q8NI51-7]
NP_001255973.1. NM_001269044.1. [Q8NI51-3]
NP_001255974.1. NM_001269045.1.
NP_001255975.1. NM_001269046.1. [Q8NI51-8]
NP_001255976.1. NM_001269047.1. [Q8NI51-2]
NP_001255977.1. NM_001269048.1. [Q8NI51-4]
NP_001255978.1. NM_001269049.1.
NP_001255979.1. NM_001269050.1. [Q8NI51-5]
NP_001255980.1. NM_001269051.1.
NP_001255981.1. NM_001269052.1.
NP_001255983.1. NM_001269054.1. [Q8NI51-6]
NP_001255984.1. NM_001269055.1.
NP_542185.2. NM_080618.3. [Q8NI51-1]
UniGeneHs.131543.

3D structure databases

ProteinModelPortalQ8NI51.
SMRQ8NI51. Positions 231-593.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid126653. 7 interactions.
IntActQ8NI51. 1 interaction.
STRING9606.ENSP00000243914.

PTM databases

PhosphoSiteQ8NI51.

Polymorphism databases

DMDM313104098.

Proteomic databases

MaxQBQ8NI51.
PaxDbQ8NI51.
PRIDEQ8NI51.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000243914; ENSP00000243914; ENSG00000124092. [Q8NI51-1]
ENST00000371196; ENSP00000360239; ENSG00000124092. [Q8NI51-1]
ENST00000422109; ENSP00000413713; ENSG00000124092. [Q8NI51-9]
ENST00000422869; ENSP00000399061; ENSG00000124092. [Q8NI51-2]
ENST00000423479; ENSP00000415579; ENSG00000124092. [Q8NI51-7]
ENST00000429804; ENSP00000415329; ENSG00000124092. [Q8NI51-8]
ENST00000432255; ENSP00000409344; ENSG00000124092. [Q8NI51-4]
ENST00000502686; ENSP00000437999; ENSG00000124092. [Q8NI51-6]
ENST00000539382; ENSP00000439998; ENSG00000124092. [Q8NI51-5]
ENST00000608263; ENSP00000476783; ENSG00000124092. [Q8NI51-1]
ENST00000608440; ENSP00000477488; ENSG00000124092. [Q8NI51-3]
ENST00000608903; ENSP00000476718; ENSG00000124092.
ENST00000609232; ENSP00000476398; ENSG00000124092. [Q8NI51-1]
GeneID140690.
KEGGhsa:140690.
UCSCuc010gix.1. human. [Q8NI51-1]
uc010gje.3. human.
uc010gjg.4. human.
uc010gjh.2. human.
uc010gji.2. human.
uc031ruj.1. human.

Organism-specific databases

CTD140690.
GeneCardsGC20M056064.
HGNCHGNC:16234. CTCFL.
HPAHPA001472.
MIM607022. gene.
neXtProtNX_Q8NI51.
PharmGKBPA26999.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOGENOMHOG000276534.
InParanoidQ8NI51.
OMACIVENTS.
OrthoDBEOG71K632.
PhylomeDBQ8NI51.
TreeFamTF106430.

Gene expression databases

BgeeQ8NI51.
CleanExHS_CTCFL.
GenevestigatorQ8NI51.

Family and domain databases

Gene3D3.30.160.60. 10 hits.
InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamPF00096. zf-C2H2. 2 hits.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 11 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 7 hits.
PS50157. ZINC_FINGER_C2H2_2. 11 hits.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiCTCFL.
GenomeRNAi140690.
NextBio35462878.
PROQ8NI51.
SOURCESearch...

Entry information

Entry nameCTCFL_HUMAN
AccessionPrimary (citable) accession number: Q8NI51
Secondary accession number(s): A0S6W1 expand/collapse secondary AC list , A1L4C6, A6XGL8, A6XGM2, A6XGM3, A6XGM8, A6XGN0, A6XGN1, A6XGN2, A6XGN3, A6XGN4, E7EQ27, E7EUE3, E9PBA9, Q5JUG4, Q9BZ30, Q9NQJ3
Entry history
Integrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: November 30, 2010
Last modified: July 9, 2014
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 20

Human chromosome 20: entries, gene names and cross-references to MIM