Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NI35

- INADL_HUMAN

UniProt

Q8NI35 - INADL_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

InaD-like protein

Gene

INADL

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Scaffolding protein that may bring different proteins into adjacent positions at the cell membrane. May regulate protein targeting, cell polarity and integrity of tight junctions. May regulate the surface expression and/or function of ASIC3 in sensory neurons.1 Publication

GO - Biological processi

  1. cell-cell junction organization Source: Reactome
  2. cell junction assembly Source: Reactome
  3. intracellular signal transduction Source: UniProtKB
  4. tight junction assembly Source: Reactome
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_19373. Tight junction interactions.
SignaLinkiQ8NI35.

Names & Taxonomyi

Protein namesi
Recommended name:
InaD-like protein
Short name:
Inadl protein
Short name:
hINADL
Alternative name(s):
Pals1-associated tight junction protein
Protein associated to tight junctions
Gene namesi
Name:INADL
Synonyms:PATJ
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:28881. INADL.

Subcellular locationi

Membrane. Cell junctiontight junction. Apical cell membrane. Cytoplasmperinuclear region
Note: Localized in the paranodal region of myelinating Schwann cells By similarity. Membrane-associated. Localizes to tight junctions in epithelial cells. Also found at the apical plasma membrane.By similarity

GO - Cellular componenti

  1. apical part of cell Source: Ensembl
  2. extracellular vesicular exosome Source: UniProtKB
  3. perinuclear region of cytoplasm Source: UniProtKB
  4. plasma membrane Source: Reactome
  5. protein complex Source: Ensembl
  6. tight junction Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Tight junction

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi19 – 191L → W: Reduces L27 domain binding affinity to MPP5 L27 domain. 1 Publication
Mutagenesisi38 – 381F → W: Reduces L27 domain binding affinity to MPP5 L27 domain. 1 Publication

Organism-specific databases

PharmGKBiPA134919267.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 18011801InaD-like proteinPRO_0000094592Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei522 – 5221Phosphoserine1 Publication
Modified residuei645 – 6451Phosphoserine1 Publication
Modified residuei1209 – 12091Phosphothreonine1 Publication
Modified residuei1212 – 12121Phosphoserine3 Publications
Modified residuei1508 – 15081Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8NI35.
PaxDbiQ8NI35.
PRIDEiQ8NI35.

PTM databases

PhosphoSiteiQ8NI35.

Expressioni

Tissue specificityi

Expressed in bladder, testis, ovary, small intestine, colon, heart, skeletal muscle, pancreas and cerebellum in the brain.2 Publications

Gene expression databases

BgeeiQ8NI35.
GenevestigatoriQ8NI35.

Interactioni

Subunit structurei

Interacts with ASIC3, KCNJ10, KCNJ15, GRIN2A, GRIN2B, GRIN2C, GRIN2D, NLGN2, MPP7, HTR2A and SLC6A4 By similarity. Forms a ternary complex with MPP5, CRB1 and CRB3. Interacts with TJP3/ZO-3 and CLDN1/claudin-1. Component of a complex whose core is composed of ARHGAP17, AMOT, MPP5/PALS1, INADL/PATJ and PARD3/PAR3. Directly interacts with HTR4 By similarity. Interacts (via PDZ domain 8) with WWC1 (via the ADDV motif).By similarity5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CRB1P822792EBI-724390,EBI-1048648
MPP5Q8N3R94EBI-724390,EBI-2513978
NF2P352402EBI-724390,EBI-1014472

Protein-protein interaction databases

BioGridi115502. 22 interactions.
IntActiQ8NI35. 19 interactions.
MINTiMINT-237883.

Structurei

Secondary structure

1
1801
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi13 – 2614
Helixi32 – 4312
Helixi45 – 6723
Helixi119 – 1279
Beta strandi131 – 1388
Beta strandi141 – 1433
Beta strandi148 – 1536
Beta strandi155 – 1584
Beta strandi160 – 1656
Helixi172 – 1754
Beta strandi184 – 1907
Helixi199 – 20810
Beta strandi211 – 2199
Beta strandi244 – 2529
Beta strandi260 – 2634
Beta strandi266 – 27510
Helixi281 – 2844
Beta strandi292 – 2987
Helixi306 – 31611
Beta strandi318 – 32710
Beta strandi361 – 3688
Beta strandi378 – 3836
Beta strandi387 – 3893
Beta strandi394 – 4007
Helixi405 – 4095
Beta strandi417 – 4215
Helixi431 – 44010
Beta strandi443 – 45715
Beta strandi685 – 6917
Beta strandi697 – 7048
Beta strandi712 – 7198
Helixi724 – 7285
Beta strandi736 – 7427
Helixi750 – 75910
Beta strandi762 – 7709
Beta strandi1058 – 10614
Beta strandi1067 – 10715
Beta strandi1075 – 10773
Beta strandi1081 – 10833
Beta strandi1101 – 11077
Beta strandi1109 – 11113
Turni1112 – 11143
Beta strandi1124 – 11307
Helixi1138 – 11469
Beta strandi1150 – 11567
Helixi1219 – 12213
Helixi1223 – 12297
Beta strandi1233 – 124311
Beta strandi1251 – 12544
Beta strandi1256 – 12583
Beta strandi1264 – 12696
Helixi1274 – 12785
Beta strandi1289 – 12924
Helixi1300 – 130910
Beta strandi1312 – 13209
Helixi1324 – 13274
Beta strandi1425 – 14273
Beta strandi1436 – 14416
Beta strandi1460 – 14634
Beta strandi1469 – 14713
Helixi1472 – 14765
Beta strandi1484 – 14885
Beta strandi1494 – 14963
Helixi1498 – 15069
Beta strandi1510 – 15178

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1VF6X-ray2.10A/B9-67[»]
2D92NMR-A676-770[»]
2DAZNMR-A1219-1329[»]
2DB5NMR-A114-228[»]
2DLUNMR-A238-335[»]
2DM8NMR-A1425-1527[»]
2DMZNMR-A355-470[»]
2EHRNMR-A1058-1167[»]
4Q2NX-ray2.00A/B/C/D/E/F362-452[»]
ProteinModelPortaliQ8NI35.
SMRiQ8NI35. Positions 10-67, 116-473, 564-637, 675-770, 1054-1198, 1219-1332, 1389-1765.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8NI35.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 6565L27PROSITE-ProRule annotationAdd
BLAST
Domaini134 – 22188PDZ 1PROSITE-ProRule annotationAdd
BLAST
Domaini248 – 32881PDZ 2PROSITE-ProRule annotationAdd
BLAST
Domaini365 – 45389PDZ 3PROSITE-ProRule annotationAdd
BLAST
Domaini553 – 63987PDZ 4PROSITE-ProRule annotationAdd
BLAST
Domaini686 – 77287PDZ 5PROSITE-ProRule annotationAdd
BLAST
Domaini1068 – 116093PDZ 6PROSITE-ProRule annotationAdd
BLAST
Domaini1239 – 132284PDZ 7PROSITE-ProRule annotationAdd
BLAST
Domaini1437 – 152084PDZ 8PROSITE-ProRule annotationAdd
BLAST
Domaini1533 – 161583PDZ 9PROSITE-ProRule annotationAdd
BLAST
Domaini1676 – 176287PDZ 10PROSITE-ProRule annotationAdd
BLAST

Domaini

The L27 domain (also called Maguk recruitment domain) is required for interaction with MPP5 and CRB3, and MPP5 localization to tight junctions.
The PDZ domain 6 mediates interaction with the C-terminus of TJP3 and is crucial for localization to the tight junctions. The PDZ domain 8 interacts with CLDN1 but is not required for proper localization.

Sequence similaritiesi

Contains 1 L27 domain.PROSITE-ProRule annotation
Contains 10 PDZ (DHR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG252837.
GeneTreeiENSGT00760000119017.
HOVERGENiHBG080134.
InParanoidiQ8NI35.
KOiK06092.
OMAiEAWEMHE.
OrthoDBiEOG72ZCD0.
PhylomeDBiQ8NI35.
TreeFamiTF330709.

Family and domain databases

Gene3Di2.30.42.10. 10 hits.
InterProiIPR004172. L27.
IPR015132. L27_2.
IPR001478. PDZ.
[Graphical view]
PfamiPF09045. L27_2. 1 hit.
PF00595. PDZ. 10 hits.
[Graphical view]
SMARTiSM00569. L27. 1 hit.
SM00228. PDZ. 10 hits.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 10 hits.
PROSITEiPS51022. L27. 1 hit.
PS50106. PDZ. 10 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8NI35-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPENPATDKL QVLQVLDRLK MKLQEKGDTS QNEKLSMFYE TLKSPLFNQI
60 70 80 90 100
LTLQQSIKQL KGQLNHIPSD CSANFDFSRK GLLVFTDGSI TNGNVHRPSN
110 120 130 140 150
NSTVSGLFPW TPKLGNEDFN SVIQQMAQGR QIEYIDIERP STGGLGFSVV
160 170 180 190 200
ALRSQNLGKV DIFVKDVQPG SVADRDQRLK ENDQILAINH TPLDQNISHQ
210 220 230 240 250
QAIALLQQTT GSLRLIVARE PVHTKSSTSS SLNDTTLPET VCWGHVEEVE
260 270 280 290 300
LINDGSGLGF GIVGGKTSGV VVRTIVPGGL ADRDGRLQTG DHILKIGGTN
310 320 330 340 350
VQGMTSEQVA QVLRNCGNSV RMLVARDPAG DISVTPPAPA ALPVALPTVA
360 370 380 390 400
SKGPGSDSSL FETYNVELVR KDGQSLGIRI VGYVGTSHTG EASGIYVKSI
410 420 430 440 450
IPGSAAYHNG HIQVNDKIVA VDGVNIQGFA NHDVVEVLRN AGQVVHLTLV
460 470 480 490 500
RRKTSSSTSP LEPPSDRGTV VEPLKPPALF LTGAVETETN VDGEDEEIKE
510 520 530 540 550
RIDTLKNDNI QALEKLEKVP DSPENELKSR WENLLGPDYE VMVATLDTQI
560 570 580 590 600
ADDAELQKYS KLLPIHTLRL GVEVDSFDGH HYISSIVSGG PVDTLGLLQP
610 620 630 640 650
EDELLEVNGM QLYGKSRREA VSFLKEVPPP FTLVCCRRLF DDEASVDEPR
660 670 680 690 700
RTETSLPETE VDHNMDVNTE EDDDGELALW SPEVKIVELV KDCKGLGFSI
710 720 730 740 750
LDYQDPLDPT RSVIVIRSLV ADGVAERSGG LLPGDRLVSV NEYCLDNTSL
760 770 780 790 800
AEAVEILKAV PPGLVHLGIC KPLVEDNEEE SCYILHSSSN EDKTEFSGTI
810 820 830 840 850
HDINSSLILE APKGFRDEPY FKEELVDEPF LDLGKSFHSQ QKEIEQSKEA
860 870 880 890 900
WEMHEFLTPR LQEMDEEREI LVDEEYELYQ DPSPSMELYP LSHIQEATPV
910 920 930 940 950
PSVNELHFGT QWLHDNEPSE SQEARTGRTV YSQEAQPYGY CPENVMKENF
960 970 980 990 1000
VMESLPSVPS TEGNSQQGRF DDLENLNSLA KTSLDLGMIP NDVQGPSLLI
1010 1020 1030 1040 1050
DLPVVAQRRE QEDLPLYQHQ ATRVISKASA YTGMLSSRYA TDTCELPERE
1060 1070 1080 1090 1100
EGEGEETPNF SHWGPPRIVE IFREPNVSLG ISIVGGQTVI KRLKNGEELK
1110 1120 1130 1140 1150
GIFIKQVLED SPAGKTNALK TGDKILEVSG VDLQNASHSE AVEAIKNAGN
1160 1170 1180 1190 1200
PVVFIVQSLS STPRVIPNVH NKANKITGNQ NQDTQEKKEK RQGTAPPPMK
1210 1220 1230 1240 1250
LPPPYKALTD DSDENEEEDA FTDQKIRQRY ADLPGELHII ELEKDKNGLG
1260 1270 1280 1290 1300
LSLAGNKDRS RMSIFVVGIN PEGPAAADGR MRIGDELLEI NNQILYGRSH
1310 1320 1330 1340 1350
QNASAIIKTA PSKVKLVFIR NEDAVNQMAV TPFPVPSSSP SSIEDQSGTE
1360 1370 1380 1390 1400
PISSEEDGSV EVGIKQLPES ESFKLAVSQM KQQKYPTKVS FSSQEIPLAP
1410 1420 1430 1440 1450
ASSYHSTDAD FTGYGGFQAP LSVDPATCPI VPGQEMIIEI SKGRSGLGLS
1460 1470 1480 1490 1500
IVGGKDTPLN AIVIHEVYEE GAAARDGRLW AGDQILEVNG VDLRNSSHEE
1510 1520 1530 1540 1550
AITALRQTPQ KVRLVVYRDE AHYRDEENLE IFPVDLQKKA GRGLGLSIVG
1560 1570 1580 1590 1600
KRNGSGVFIS DIVKGGAADL DGRLIQGDQI LSVNGEDMRN ASQETVATIL
1610 1620 1630 1640 1650
KCAQGLVQLE IGRLRAGSWT SARTTSQNSQ GSQQSAHSSC HPSFAPVITG
1660 1670 1680 1690 1700
LQNLVGTKRV SDPSQKNSGT DMEPRTVEIN RELSDALGIS IAGGRGSPLG
1710 1720 1730 1740 1750
DIPVFIAMIQ ASGVAARTQK LKVGDRIVSI NGQPLDGLSH ADVVNLLKNA
1760 1770 1780 1790 1800
YGRIILQVVA DTNISAIAAQ LENMSTGYHL GSPTAEHHPE DTEEQLQMTA

D
Length:1,801
Mass (Da):196,368
Last modified:October 17, 2006 - v3
Checksum:i313DD1F12B6AD80A
GO
Isoform 2 (identifier: Q8NI35-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1459-1459: L → LFWRLGSPRAWSQHLVRAFMLHHPVTEVEGQ
     1553-1801: Missing.

Show »
Length:1,582
Mass (Da):173,793
Checksum:i9444B48DB84DE81E
GO
Isoform 3 (identifier: Q8NI35-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1553-1801: Missing.

Show »
Length:1,552
Mass (Da):170,238
Checksum:i646145A57C61152A
GO
Isoform 4 (identifier: Q8NI35-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1460-1487: Missing.
     1553-1801: Missing.

Show »
Length:1,524
Mass (Da):167,159
Checksum:i5203884719B4B152
GO
Isoform 5 (identifier: Q8NI35-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-541: Missing.
     1631-1675: GSQQSAHSSC...KNSGTDMEPR → SAECTQQLSS...FRHRYGTKDC
     1676-1801: Missing.

Show »
Length:1,134
Mass (Da):125,231
Checksum:i2717B2D492419866
GO

Sequence cautioni

The sequence CAH70416.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAI21733.1 differs from that shown. Reason: Erroneous gene model prediction.
The sequence CAI22258.1 differs from that shown. Reason: Erroneous gene model prediction.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1443 – 14431G → R in CAA04666. (PubMed:9280290)Curated
Sequence conflicti1699 – 16991L → I in AAM28433. (PubMed:11927608)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti303 – 3031G → R.
Corresponds to variant rs3762321 [ dbSNP | Ensembl ].
VAR_027988
Natural varianti362 – 3621E → A.
Corresponds to variant rs1286823 [ dbSNP | Ensembl ].
VAR_027989
Natural varianti400 – 4001I → V.
Corresponds to variant rs7516332 [ dbSNP | Ensembl ].
VAR_027990
Natural varianti599 – 5991Q → H.
Corresponds to variant rs1286812 [ dbSNP | Ensembl ].
VAR_027991
Natural varianti744 – 7441C → R.1 Publication
Corresponds to variant rs1134764 [ dbSNP | Ensembl ].
VAR_022695
Natural varianti779 – 7791E → K.
Corresponds to variant rs12141598 [ dbSNP | Ensembl ].
VAR_027992
Natural varianti780 – 7801E → K.
Corresponds to variant rs12141599 [ dbSNP | Ensembl ].
VAR_027993
Natural varianti870 – 8701I → M.3 Publications
Corresponds to variant rs2799627 [ dbSNP | Ensembl ].
VAR_027994
Natural varianti1178 – 11781G → S.1 Publication
Corresponds to variant rs1056513 [ dbSNP | Ensembl ].
VAR_027995
Natural varianti1282 – 12821R → H.2 Publications
Corresponds to variant rs1134767 [ dbSNP | Ensembl ].
VAR_027996
Natural varianti1360 – 13601V → L.2 Publications
Corresponds to variant rs2498982 [ dbSNP | Ensembl ].
VAR_027997
Natural varianti1504 – 15041A → P.
Corresponds to variant rs13376115 [ dbSNP | Ensembl ].
VAR_027998

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 541541Missing in isoform 5. 1 PublicationVSP_014204Add
BLAST
Alternative sequencei1459 – 14591L → LFWRLGSPRAWSQHLVRAFM LHHPVTEVEGQ in isoform 2. 1 PublicationVSP_014205
Alternative sequencei1460 – 148728Missing in isoform 4. 1 PublicationVSP_014206Add
BLAST
Alternative sequencei1553 – 1801249Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationVSP_014207Add
BLAST
Alternative sequencei1631 – 167545GSQQS…DMEPR → SAECTQQLSSLLRSCHHWPA KPGWHKKSFRSFPEKFRHRY GTKDC in isoform 5. 1 PublicationVSP_014208Add
BLAST
Alternative sequencei1676 – 1801126Missing in isoform 5. 1 PublicationVSP_014209Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ001306 mRNA. Translation: CAA04666.1.
AJ224747 mRNA. Translation: CAA12112.1.
AJ224748 mRNA. Translation: CAA12113.1.
AB044807 mRNA. Translation: BAB19683.1.
AF397170 mRNA. Translation: AAM28433.1.
AL590374, AL136458, AL353802 Genomic DNA. Translation: CAH70416.1. Sequence problems.
AL590374
, AC097064, AL136458, AL353802, AL449143 Genomic DNA. Translation: CAH70418.1.
AL590374
, AC097064, AL136458, AL353802, AL449143 Genomic DNA. Translation: CAH70420.1.
AL353802, AL136458, AL590374 Genomic DNA. Translation: CAI22258.1. Sequence problems.
AL353802
, AC097064, AL136458, AL449143, AL590374 Genomic DNA. Translation: CAI22260.1.
AL353802
, AC097064, AL136458, AL449143, AL590374 Genomic DNA. Translation: CAI22262.1.
AL449143
, AC097064, AL136458, AL353802, AL590374 Genomic DNA. Translation: CAI15923.1.
AL449143
, AC097064, AL136458, AL353802, AL590374 Genomic DNA. Translation: CAI15925.1.
AL136458, AL353802, AL590374 Genomic DNA. Translation: CAI21733.1. Sequence problems.
AL136458
, AC097064, AL353802, AL449143, AL590374 Genomic DNA. Translation: CAI21734.1.
AL136458
, AC097064, AL353802, AL449143, AL590374 Genomic DNA. Translation: CAI21737.1.
BC021135 mRNA. Translation: AAH21135.1.
CCDSiCCDS617.2. [Q8NI35-1]
RefSeqiNP_795352.2. NM_176877.2.
UniGeneiHs.478125.

Genome annotation databases

EnsembliENST00000316485; ENSP00000326199; ENSG00000132849. [Q8NI35-2]
ENST00000371158; ENSP00000360200; ENSG00000132849. [Q8NI35-1]
ENST00000484937; ENSP00000433669; ENSG00000132849. [Q8NI35-5]
GeneIDi10207.
KEGGihsa:10207.
UCSCiuc001daa.2. human. [Q8NI35-4]
uc001dab.3. human. [Q8NI35-1]
uc009waf.1. human. [Q8NI35-2]

Polymorphism databases

DMDMi116242542.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ001306 mRNA. Translation: CAA04666.1 .
AJ224747 mRNA. Translation: CAA12112.1 .
AJ224748 mRNA. Translation: CAA12113.1 .
AB044807 mRNA. Translation: BAB19683.1 .
AF397170 mRNA. Translation: AAM28433.1 .
AL590374 , AL136458 , AL353802 Genomic DNA. Translation: CAH70416.1 . Sequence problems.
AL590374
, AC097064 , AL136458 , AL353802 , AL449143 Genomic DNA. Translation: CAH70418.1 .
AL590374
, AC097064 , AL136458 , AL353802 , AL449143 Genomic DNA. Translation: CAH70420.1 .
AL353802 , AL136458 , AL590374 Genomic DNA. Translation: CAI22258.1 . Sequence problems.
AL353802
, AC097064 , AL136458 , AL449143 , AL590374 Genomic DNA. Translation: CAI22260.1 .
AL353802
, AC097064 , AL136458 , AL449143 , AL590374 Genomic DNA. Translation: CAI22262.1 .
AL449143
, AC097064 , AL136458 , AL353802 , AL590374 Genomic DNA. Translation: CAI15923.1 .
AL449143
, AC097064 , AL136458 , AL353802 , AL590374 Genomic DNA. Translation: CAI15925.1 .
AL136458 , AL353802 , AL590374 Genomic DNA. Translation: CAI21733.1 . Sequence problems.
AL136458
, AC097064 , AL353802 , AL449143 , AL590374 Genomic DNA. Translation: CAI21734.1 .
AL136458
, AC097064 , AL353802 , AL449143 , AL590374 Genomic DNA. Translation: CAI21737.1 .
BC021135 mRNA. Translation: AAH21135.1 .
CCDSi CCDS617.2. [Q8NI35-1 ]
RefSeqi NP_795352.2. NM_176877.2.
UniGenei Hs.478125.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1VF6 X-ray 2.10 A/B 9-67 [» ]
2D92 NMR - A 676-770 [» ]
2DAZ NMR - A 1219-1329 [» ]
2DB5 NMR - A 114-228 [» ]
2DLU NMR - A 238-335 [» ]
2DM8 NMR - A 1425-1527 [» ]
2DMZ NMR - A 355-470 [» ]
2EHR NMR - A 1058-1167 [» ]
4Q2N X-ray 2.00 A/B/C/D/E/F 362-452 [» ]
ProteinModelPortali Q8NI35.
SMRi Q8NI35. Positions 10-67, 116-473, 564-637, 675-770, 1054-1198, 1219-1332, 1389-1765.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115502. 22 interactions.
IntActi Q8NI35. 19 interactions.
MINTi MINT-237883.

PTM databases

PhosphoSitei Q8NI35.

Polymorphism databases

DMDMi 116242542.

Proteomic databases

MaxQBi Q8NI35.
PaxDbi Q8NI35.
PRIDEi Q8NI35.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000316485 ; ENSP00000326199 ; ENSG00000132849 . [Q8NI35-2 ]
ENST00000371158 ; ENSP00000360200 ; ENSG00000132849 . [Q8NI35-1 ]
ENST00000484937 ; ENSP00000433669 ; ENSG00000132849 . [Q8NI35-5 ]
GeneIDi 10207.
KEGGi hsa:10207.
UCSCi uc001daa.2. human. [Q8NI35-4 ]
uc001dab.3. human. [Q8NI35-1 ]
uc009waf.1. human. [Q8NI35-2 ]

Organism-specific databases

CTDi 10207.
GeneCardsi GC01P062208.
HGNCi HGNC:28881. INADL.
MIMi 603199. gene.
neXtProti NX_Q8NI35.
PharmGKBi PA134919267.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG252837.
GeneTreei ENSGT00760000119017.
HOVERGENi HBG080134.
InParanoidi Q8NI35.
KOi K06092.
OMAi EAWEMHE.
OrthoDBi EOG72ZCD0.
PhylomeDBi Q8NI35.
TreeFami TF330709.

Enzyme and pathway databases

Reactomei REACT_19373. Tight junction interactions.
SignaLinki Q8NI35.

Miscellaneous databases

ChiTaRSi INADL. human.
EvolutionaryTracei Q8NI35.
GeneWikii INADL.
GenomeRNAii 10207.
NextBioi 38644.
PROi Q8NI35.
SOURCEi Search...

Gene expression databases

Bgeei Q8NI35.
Genevestigatori Q8NI35.

Family and domain databases

Gene3Di 2.30.42.10. 10 hits.
InterProi IPR004172. L27.
IPR015132. L27_2.
IPR001478. PDZ.
[Graphical view ]
Pfami PF09045. L27_2. 1 hit.
PF00595. PDZ. 10 hits.
[Graphical view ]
SMARTi SM00569. L27. 1 hit.
SM00228. PDZ. 10 hits.
[Graphical view ]
SUPFAMi SSF50156. SSF50156. 10 hits.
PROSITEi PS51022. L27. 1 hit.
PS50106. PDZ. 10 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular characterization of a novel PDZ domain protein with homology to INAD from Drosophila melanogaster."
    Philipp S., Flockerzi V.
    FEBS Lett. 413:243-248(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), TISSUE SPECIFICITY, VARIANTS ARG-744; MET-870; HIS-1282 AND LEU-1360.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), VARIANTS MET-870; HIS-1282 AND LEU-1360.
  3. "The Maguk protein, Pals1, functions as an adapter, linking mammalian homologues of Crumbs and Discs Lost."
    Roh M.H., Makarova O., Liu C.-J., Shin K., Lee S., Laurinec S., Goyal M., Wiggins R., Margolis B.
    J. Cell Biol. 157:161-172(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH MPP5 AND CRB1, SUBCELLULAR LOCATION, DOMAIN, IDENTIFICATION BY MASS SPECTROMETRY, FUNCTION, VARIANTS MET-870 AND SER-1178.
    Tissue: Kidney.
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1456-1801 (ISOFORM 1).
    Tissue: Skin.
  6. "hINADl/PATJ, a homolog of discs lost, interacts with crumbs and localizes to tight junctions in human epithelial cells."
    Lemmers C., Medina E., Delgrossi M.-H., Michel D., Arsanto J.-P., Le Bivic A.
    J. Biol. Chem. 277:25408-25415(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DOMAIN, INTERACTION WITH CRB1 AND CRB3.
  7. "The carboxyl terminus of zona occludens-3 binds and recruits a mammalian homologue of discs lost to tight junctions."
    Roh M.H., Liu C.-J., Laurinec S., Margolis B.
    J. Biol. Chem. 277:27501-27509(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, DOMAINS, INTERACTION WITH TJP3 AND CLDN1.
  8. "A Rich1/Amot complex regulates the Cdc42 GTPase and apical-polarity proteins in epithelial cells."
    Wells C.D., Fawcett J.P., Traweger A., Yamanaka Y., Goudreault M., Elder K., Kulkarni S., Gish G., Virag C., Lim C., Colwill K., Starostine A., Metalnikov P., Pawson T.
    Cell 125:535-548(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN A COMPLEX WITH ARHGAP17; AMOT; MPP5 AND PARD3, INTERACTION WITH MPP7.
  9. Cited for: SUBCELLULAR LOCATION, INTERACTION WITH WWC1.
  10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-1209 AND SER-1212, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-522; SER-645; SER-1212 AND THR-1508, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1212, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  14. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  15. "Structural basis for L27 domain-mediated assembly of signaling and cell polarity complexes."
    Li Y., Karnak D., Demeler B., Margolis B., Lavie A.
    EMBO J. 23:2723-2733(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.1 ANGSTROMS) OF 9-67, MUTAGENESIS OF LEU-19 AND PHE-38.
  16. "Solution structure of PDZ domains of INAD-like protein."
    RIKEN structural genomics initiative (RSGI)
    Submitted (OCT-2006) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 114-470; 675-770 AND 1219-1527.

Entry informationi

Entry nameiINADL_HUMAN
AccessioniPrimary (citable) accession number: Q8NI35
Secondary accession number(s): O15249
, O43742, O60833, Q5VUA5, Q5VUA6, Q5VUA7, Q5VUA8, Q5VUA9, Q5VUB0, Q8WU78, Q9H3N9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: October 17, 2006
Last modified: October 29, 2014
This is version 113 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3