Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

InaD-like protein

Gene

PATJ

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Scaffolding protein that may bring different proteins into adjacent positions at the cell membrane. May regulate protein targeting, cell polarity and integrity of tight junctions. May regulate the surface expression and/or function of ASIC3 in sensory neurons. May recruit ARHGEF18 to apical cell-cell boundaries (PubMed:22006950).2 Publications

GO - Biological processi

  • bicellular tight junction assembly Source: Reactome
  • intracellular signal transduction Source: UniProtKB
Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-420029. Tight junction interactions.
SignaLinkiQ8NI35.
SIGNORiQ8NI35.

Names & Taxonomyi

Protein namesi
Recommended name:
InaD-like protein
Short name:
Inadl protein
Short name:
hINADL
Alternative name(s):
Pals1-associated tight junction protein
Protein associated to tight junctions
Gene namesi
Name:PATJ1 PublicationImported
Synonyms:INADL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:28881. PATJ.

Subcellular locationi

  • Cell junctiontight junction 1 Publication
  • Apical cell membrane By similarity; Peripheral membrane protein By similarity
  • Cytoplasmperinuclear region By similarity
  • Cell membrane By similarity; Peripheral membrane protein By similarity

  • Note: Localized in the paranodal region of myelinating Schwann cells (By similarity). Membrane-associated. Localizes to tight junctions in epithelial cells (PubMed:22006950). Also found at the apical plasma membrane.By similarity1 Publication

GO - Cellular componenti

  • apical plasma membrane Source: UniProtKB-SubCell
  • bicellular tight junction Source: MGI
  • extracellular exosome Source: UniProtKB
  • perinuclear region of cytoplasm Source: UniProtKB
  • plasma membrane Source: Reactome
  • protein complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Tight junction

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi19L → W: Reduces L27 domain binding affinity to MPP5 L27 domain. 1 Publication1
Mutagenesisi38F → W: Reduces L27 domain binding affinity to MPP5 L27 domain. 1 Publication1

Organism-specific databases

DisGeNETi10207.
OpenTargetsiENSG00000132849.
PharmGKBiPA134919267.

Polymorphism and mutation databases

BioMutaiINADL.
DMDMi116242542.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000945921 – 1801InaD-like proteinAdd BLAST1801

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei455PhosphoserineCombined sources1
Modified residuei459PhosphoserineCombined sources1
Modified residuei522PhosphoserineCombined sources1
Modified residuei645PhosphoserineCombined sources1
Modified residuei1209PhosphothreonineCombined sources1
Modified residuei1212PhosphoserineCombined sources1
Modified residuei1508PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8NI35.
MaxQBiQ8NI35.
PaxDbiQ8NI35.
PeptideAtlasiQ8NI35.
PRIDEiQ8NI35.

PTM databases

iPTMnetiQ8NI35.
PhosphoSitePlusiQ8NI35.

Expressioni

Tissue specificityi

Expressed in bladder, testis, ovary, small intestine, colon, heart, skeletal muscle, pancreas and cerebellum in the brain.2 Publications

Gene expression databases

BgeeiENSG00000132849.
ExpressionAtlasiQ8NI35. baseline and differential.
GenevisibleiQ8NI35. HS.

Organism-specific databases

HPAiHPA066352.

Interactioni

Subunit structurei

Interacts with ASIC3, KCNJ10, KCNJ15, GRIN2A, GRIN2B, GRIN2C, GRIN2D, NLGN2, MPP7, HTR2A and SLC6A4 (By similarity). Forms a ternary complex with MPP5, CRB1 and CRB3. Interacts with TJP3/ZO-3 and CLDN1/claudin-1. Component of a complex whose core is composed of ARHGAP17, AMOT, MPP5/PALS1, INADL/PATJ and PARD3/PAR3. Directly interacts with HTR4 (By similarity). Interacts (via PDZ domain 8) with WWC1 (via the ADDV motif). Interacts (via C-terminus) with ARHGEF18 (PubMed:22006950).By similarity6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CRB1P822792EBI-724390,EBI-1048648
MPP5Q8N3R94EBI-724390,EBI-2513978
NF2P352402EBI-724390,EBI-1014472

Protein-protein interaction databases

BioGridi115502. 36 interactors.
IntActiQ8NI35. 35 interactors.
MINTiMINT-237883.
STRINGi9606.ENSP00000360200.

Structurei

Secondary structure

11801
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi13 – 26Combined sources14
Helixi32 – 43Combined sources12
Helixi45 – 67Combined sources23
Helixi119 – 127Combined sources9
Beta strandi131 – 138Combined sources8
Beta strandi141 – 143Combined sources3
Beta strandi148 – 153Combined sources6
Beta strandi155 – 158Combined sources4
Beta strandi160 – 165Combined sources6
Helixi172 – 175Combined sources4
Beta strandi184 – 190Combined sources7
Helixi199 – 208Combined sources10
Beta strandi211 – 219Combined sources9
Beta strandi244 – 252Combined sources9
Beta strandi260 – 263Combined sources4
Beta strandi266 – 275Combined sources10
Helixi281 – 284Combined sources4
Beta strandi292 – 298Combined sources7
Helixi306 – 316Combined sources11
Beta strandi318 – 327Combined sources10
Beta strandi362 – 369Combined sources8
Beta strandi378 – 382Combined sources5
Beta strandi387 – 389Combined sources3
Beta strandi395 – 400Combined sources6
Helixi405 – 409Combined sources5
Beta strandi417 – 421Combined sources5
Helixi431 – 439Combined sources9
Beta strandi443 – 452Combined sources10
Beta strandi685 – 691Combined sources7
Beta strandi697 – 704Combined sources8
Beta strandi712 – 719Combined sources8
Helixi724 – 728Combined sources5
Beta strandi736 – 742Combined sources7
Helixi750 – 759Combined sources10
Beta strandi762 – 770Combined sources9
Beta strandi1058 – 1061Combined sources4
Beta strandi1067 – 1071Combined sources5
Beta strandi1075 – 1077Combined sources3
Beta strandi1081 – 1083Combined sources3
Beta strandi1101 – 1107Combined sources7
Beta strandi1109 – 1111Combined sources3
Turni1112 – 1114Combined sources3
Beta strandi1124 – 1130Combined sources7
Helixi1138 – 1146Combined sources9
Beta strandi1150 – 1156Combined sources7
Helixi1219 – 1221Combined sources3
Helixi1223 – 1229Combined sources7
Beta strandi1233 – 1243Combined sources11
Beta strandi1251 – 1254Combined sources4
Beta strandi1256 – 1258Combined sources3
Beta strandi1264 – 1269Combined sources6
Helixi1274 – 1278Combined sources5
Beta strandi1289 – 1292Combined sources4
Helixi1300 – 1309Combined sources10
Beta strandi1312 – 1320Combined sources9
Helixi1324 – 1327Combined sources4
Beta strandi1425 – 1427Combined sources3
Beta strandi1436 – 1441Combined sources6
Beta strandi1460 – 1463Combined sources4
Beta strandi1469 – 1471Combined sources3
Helixi1472 – 1476Combined sources5
Beta strandi1484 – 1488Combined sources5
Beta strandi1494 – 1496Combined sources3
Helixi1498 – 1506Combined sources9
Beta strandi1510 – 1517Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1VF6X-ray2.10A/B9-67[»]
2D92NMR-A676-770[»]
2DAZNMR-A1219-1329[»]
2DB5NMR-A114-228[»]
2DLUNMR-A238-335[»]
2DM8NMR-A1425-1527[»]
2DMZNMR-A355-470[»]
2EHRNMR-A1058-1167[»]
4Q2NX-ray2.00A/B/C/D/E/F362-452[»]
ProteinModelPortaliQ8NI35.
SMRiQ8NI35.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8NI35.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 65L27PROSITE-ProRule annotationAdd BLAST65
Domaini134 – 221PDZ 1PROSITE-ProRule annotationAdd BLAST88
Domaini248 – 328PDZ 2PROSITE-ProRule annotationAdd BLAST81
Domaini365 – 453PDZ 3PROSITE-ProRule annotationAdd BLAST89
Domaini553 – 639PDZ 4PROSITE-ProRule annotationAdd BLAST87
Domaini686 – 772PDZ 5PROSITE-ProRule annotationAdd BLAST87
Domaini1068 – 1160PDZ 6PROSITE-ProRule annotationAdd BLAST93
Domaini1239 – 1322PDZ 7PROSITE-ProRule annotationAdd BLAST84
Domaini1437 – 1520PDZ 8PROSITE-ProRule annotationAdd BLAST84
Domaini1533 – 1615PDZ 9PROSITE-ProRule annotationAdd BLAST83
Domaini1676 – 1762PDZ 10PROSITE-ProRule annotationAdd BLAST87

Domaini

The L27 domain (also called Maguk recruitment domain) is required for interaction with MPP5 and CRB3, and MPP5 localization to tight junctions.
The PDZ domain 6 mediates interaction with the C-terminus of TJP3 and is crucial for localization to the tight junctions. The PDZ domain 8 interacts with CLDN1 but is not required for proper localization.

Sequence similaritiesi

Contains 1 L27 domain.PROSITE-ProRule annotation
Contains 10 PDZ (DHR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
KOG3528. Eukaryota.
ENOG4110362. LUCA.
GeneTreeiENSGT00760000119017.
HOVERGENiHBG080134.
InParanoidiQ8NI35.
KOiK06092.
OMAiEAWEMHE.
OrthoDBiEOG091G0P7K.
PhylomeDBiQ8NI35.
TreeFamiTF330709.

Family and domain databases

Gene3Di2.30.42.10. 10 hits.
InterProiIPR015132. L27_2.
IPR004172. L27_dom.
IPR001478. PDZ.
[Graphical view]
PfamiPF09045. L27_2. 1 hit.
PF00595. PDZ. 9 hits.
[Graphical view]
SMARTiSM00569. L27. 1 hit.
SM00228. PDZ. 10 hits.
[Graphical view]
SUPFAMiSSF101288. SSF101288. 1 hit.
SSF50156. SSF50156. 10 hits.
PROSITEiPS51022. L27. 1 hit.
PS50106. PDZ. 10 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NI35-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPENPATDKL QVLQVLDRLK MKLQEKGDTS QNEKLSMFYE TLKSPLFNQI
60 70 80 90 100
LTLQQSIKQL KGQLNHIPSD CSANFDFSRK GLLVFTDGSI TNGNVHRPSN
110 120 130 140 150
NSTVSGLFPW TPKLGNEDFN SVIQQMAQGR QIEYIDIERP STGGLGFSVV
160 170 180 190 200
ALRSQNLGKV DIFVKDVQPG SVADRDQRLK ENDQILAINH TPLDQNISHQ
210 220 230 240 250
QAIALLQQTT GSLRLIVARE PVHTKSSTSS SLNDTTLPET VCWGHVEEVE
260 270 280 290 300
LINDGSGLGF GIVGGKTSGV VVRTIVPGGL ADRDGRLQTG DHILKIGGTN
310 320 330 340 350
VQGMTSEQVA QVLRNCGNSV RMLVARDPAG DISVTPPAPA ALPVALPTVA
360 370 380 390 400
SKGPGSDSSL FETYNVELVR KDGQSLGIRI VGYVGTSHTG EASGIYVKSI
410 420 430 440 450
IPGSAAYHNG HIQVNDKIVA VDGVNIQGFA NHDVVEVLRN AGQVVHLTLV
460 470 480 490 500
RRKTSSSTSP LEPPSDRGTV VEPLKPPALF LTGAVETETN VDGEDEEIKE
510 520 530 540 550
RIDTLKNDNI QALEKLEKVP DSPENELKSR WENLLGPDYE VMVATLDTQI
560 570 580 590 600
ADDAELQKYS KLLPIHTLRL GVEVDSFDGH HYISSIVSGG PVDTLGLLQP
610 620 630 640 650
EDELLEVNGM QLYGKSRREA VSFLKEVPPP FTLVCCRRLF DDEASVDEPR
660 670 680 690 700
RTETSLPETE VDHNMDVNTE EDDDGELALW SPEVKIVELV KDCKGLGFSI
710 720 730 740 750
LDYQDPLDPT RSVIVIRSLV ADGVAERSGG LLPGDRLVSV NEYCLDNTSL
760 770 780 790 800
AEAVEILKAV PPGLVHLGIC KPLVEDNEEE SCYILHSSSN EDKTEFSGTI
810 820 830 840 850
HDINSSLILE APKGFRDEPY FKEELVDEPF LDLGKSFHSQ QKEIEQSKEA
860 870 880 890 900
WEMHEFLTPR LQEMDEEREI LVDEEYELYQ DPSPSMELYP LSHIQEATPV
910 920 930 940 950
PSVNELHFGT QWLHDNEPSE SQEARTGRTV YSQEAQPYGY CPENVMKENF
960 970 980 990 1000
VMESLPSVPS TEGNSQQGRF DDLENLNSLA KTSLDLGMIP NDVQGPSLLI
1010 1020 1030 1040 1050
DLPVVAQRRE QEDLPLYQHQ ATRVISKASA YTGMLSSRYA TDTCELPERE
1060 1070 1080 1090 1100
EGEGEETPNF SHWGPPRIVE IFREPNVSLG ISIVGGQTVI KRLKNGEELK
1110 1120 1130 1140 1150
GIFIKQVLED SPAGKTNALK TGDKILEVSG VDLQNASHSE AVEAIKNAGN
1160 1170 1180 1190 1200
PVVFIVQSLS STPRVIPNVH NKANKITGNQ NQDTQEKKEK RQGTAPPPMK
1210 1220 1230 1240 1250
LPPPYKALTD DSDENEEEDA FTDQKIRQRY ADLPGELHII ELEKDKNGLG
1260 1270 1280 1290 1300
LSLAGNKDRS RMSIFVVGIN PEGPAAADGR MRIGDELLEI NNQILYGRSH
1310 1320 1330 1340 1350
QNASAIIKTA PSKVKLVFIR NEDAVNQMAV TPFPVPSSSP SSIEDQSGTE
1360 1370 1380 1390 1400
PISSEEDGSV EVGIKQLPES ESFKLAVSQM KQQKYPTKVS FSSQEIPLAP
1410 1420 1430 1440 1450
ASSYHSTDAD FTGYGGFQAP LSVDPATCPI VPGQEMIIEI SKGRSGLGLS
1460 1470 1480 1490 1500
IVGGKDTPLN AIVIHEVYEE GAAARDGRLW AGDQILEVNG VDLRNSSHEE
1510 1520 1530 1540 1550
AITALRQTPQ KVRLVVYRDE AHYRDEENLE IFPVDLQKKA GRGLGLSIVG
1560 1570 1580 1590 1600
KRNGSGVFIS DIVKGGAADL DGRLIQGDQI LSVNGEDMRN ASQETVATIL
1610 1620 1630 1640 1650
KCAQGLVQLE IGRLRAGSWT SARTTSQNSQ GSQQSAHSSC HPSFAPVITG
1660 1670 1680 1690 1700
LQNLVGTKRV SDPSQKNSGT DMEPRTVEIN RELSDALGIS IAGGRGSPLG
1710 1720 1730 1740 1750
DIPVFIAMIQ ASGVAARTQK LKVGDRIVSI NGQPLDGLSH ADVVNLLKNA
1760 1770 1780 1790 1800
YGRIILQVVA DTNISAIAAQ LENMSTGYHL GSPTAEHHPE DTEEQLQMTA

D
Length:1,801
Mass (Da):196,368
Last modified:October 17, 2006 - v3
Checksum:i313DD1F12B6AD80A
GO
Isoform 2 (identifier: Q8NI35-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1459-1459: L → LFWRLGSPRAWSQHLVRAFMLHHPVTEVEGQ
     1553-1801: Missing.

Show »
Length:1,582
Mass (Da):173,793
Checksum:i9444B48DB84DE81E
GO
Isoform 3 (identifier: Q8NI35-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1553-1801: Missing.

Show »
Length:1,552
Mass (Da):170,238
Checksum:i646145A57C61152A
GO
Isoform 4 (identifier: Q8NI35-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1460-1487: Missing.
     1553-1801: Missing.

Show »
Length:1,524
Mass (Da):167,159
Checksum:i5203884719B4B152
GO
Isoform 5 (identifier: Q8NI35-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-541: Missing.
     1631-1675: GSQQSAHSSC...KNSGTDMEPR → SAECTQQLSS...FRHRYGTKDC
     1676-1801: Missing.

Show »
Length:1,134
Mass (Da):125,231
Checksum:i2717B2D492419866
GO

Sequence cautioni

The sequence CAH70416 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI21733 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAI22258 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti1443G → R in CAA04666 (PubMed:9280290).Curated1
Sequence conflicti1699L → I in AAM28433 (PubMed:11927608).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_027988303G → R.Corresponds to variant rs3762321dbSNPEnsembl.1
Natural variantiVAR_027989362E → A.Corresponds to variant rs1286823dbSNPEnsembl.1
Natural variantiVAR_027990400I → V.Corresponds to variant rs7516332dbSNPEnsembl.1
Natural variantiVAR_027991599Q → H.Corresponds to variant rs1286812dbSNPEnsembl.1
Natural variantiVAR_022695744C → R.1 PublicationCorresponds to variant rs1134764dbSNPEnsembl.1
Natural variantiVAR_027992779E → K.Corresponds to variant rs12141598dbSNPEnsembl.1
Natural variantiVAR_027993780E → K.Corresponds to variant rs12141599dbSNPEnsembl.1
Natural variantiVAR_027994870I → M.3 PublicationsCorresponds to variant rs2799627dbSNPEnsembl.1
Natural variantiVAR_0279951178G → S.1 PublicationCorresponds to variant rs1056513dbSNPEnsembl.1
Natural variantiVAR_0279961282R → H.2 PublicationsCorresponds to variant rs1134767dbSNPEnsembl.1
Natural variantiVAR_0279971360V → L.2 PublicationsCorresponds to variant rs2498982dbSNPEnsembl.1
Natural variantiVAR_0279981504A → P.Corresponds to variant rs13376115dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0142041 – 541Missing in isoform 5. 1 PublicationAdd BLAST541
Alternative sequenceiVSP_0142051459L → LFWRLGSPRAWSQHLVRAFM LHHPVTEVEGQ in isoform 2. 1 Publication1
Alternative sequenceiVSP_0142061460 – 1487Missing in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_0142071553 – 1801Missing in isoform 2, isoform 3 and isoform 4. 1 PublicationAdd BLAST249
Alternative sequenceiVSP_0142081631 – 1675GSQQS…DMEPR → SAECTQQLSSLLRSCHHWPA KPGWHKKSFRSFPEKFRHRY GTKDC in isoform 5. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_0142091676 – 1801Missing in isoform 5. 1 PublicationAdd BLAST126

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001306 mRNA. Translation: CAA04666.1.
AJ224747 mRNA. Translation: CAA12112.1.
AJ224748 mRNA. Translation: CAA12113.1.
AB044807 mRNA. Translation: BAB19683.1.
AF397170 mRNA. Translation: AAM28433.1.
AL590374, AL136458, AL353802 Genomic DNA. Translation: CAH70416.1. Sequence problems.
AL590374
, AC097064, AL136458, AL353802, AL449143 Genomic DNA. Translation: CAH70418.1.
AL590374
, AC097064, AL136458, AL353802, AL449143 Genomic DNA. Translation: CAH70420.1.
AL353802, AL136458, AL590374 Genomic DNA. Translation: CAI22258.1. Sequence problems.
AL353802
, AC097064, AL136458, AL449143, AL590374 Genomic DNA. Translation: CAI22260.1.
AL353802
, AC097064, AL136458, AL449143, AL590374 Genomic DNA. Translation: CAI22262.1.
AL449143
, AC097064, AL136458, AL353802, AL590374 Genomic DNA. Translation: CAI15923.1.
AL449143
, AC097064, AL136458, AL353802, AL590374 Genomic DNA. Translation: CAI15925.1.
AL136458, AL353802, AL590374 Genomic DNA. Translation: CAI21733.1. Sequence problems.
AL136458
, AC097064, AL353802, AL449143, AL590374 Genomic DNA. Translation: CAI21734.1.
AL136458
, AC097064, AL353802, AL449143, AL590374 Genomic DNA. Translation: CAI21737.1.
BC021135 mRNA. Translation: AAH21135.1.
CCDSiCCDS617.2. [Q8NI35-1]
RefSeqiNP_795352.2. NM_176877.2.
UniGeneiHs.478125.

Genome annotation databases

EnsembliENST00000371158; ENSP00000360200; ENSG00000132849. [Q8NI35-1]
ENST00000484937; ENSP00000433669; ENSG00000132849. [Q8NI35-5]
GeneIDi10207.
KEGGihsa:10207.
UCSCiuc001dab.4. human. [Q8NI35-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ001306 mRNA. Translation: CAA04666.1.
AJ224747 mRNA. Translation: CAA12112.1.
AJ224748 mRNA. Translation: CAA12113.1.
AB044807 mRNA. Translation: BAB19683.1.
AF397170 mRNA. Translation: AAM28433.1.
AL590374, AL136458, AL353802 Genomic DNA. Translation: CAH70416.1. Sequence problems.
AL590374
, AC097064, AL136458, AL353802, AL449143 Genomic DNA. Translation: CAH70418.1.
AL590374
, AC097064, AL136458, AL353802, AL449143 Genomic DNA. Translation: CAH70420.1.
AL353802, AL136458, AL590374 Genomic DNA. Translation: CAI22258.1. Sequence problems.
AL353802
, AC097064, AL136458, AL449143, AL590374 Genomic DNA. Translation: CAI22260.1.
AL353802
, AC097064, AL136458, AL449143, AL590374 Genomic DNA. Translation: CAI22262.1.
AL449143
, AC097064, AL136458, AL353802, AL590374 Genomic DNA. Translation: CAI15923.1.
AL449143
, AC097064, AL136458, AL353802, AL590374 Genomic DNA. Translation: CAI15925.1.
AL136458, AL353802, AL590374 Genomic DNA. Translation: CAI21733.1. Sequence problems.
AL136458
, AC097064, AL353802, AL449143, AL590374 Genomic DNA. Translation: CAI21734.1.
AL136458
, AC097064, AL353802, AL449143, AL590374 Genomic DNA. Translation: CAI21737.1.
BC021135 mRNA. Translation: AAH21135.1.
CCDSiCCDS617.2. [Q8NI35-1]
RefSeqiNP_795352.2. NM_176877.2.
UniGeneiHs.478125.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1VF6X-ray2.10A/B9-67[»]
2D92NMR-A676-770[»]
2DAZNMR-A1219-1329[»]
2DB5NMR-A114-228[»]
2DLUNMR-A238-335[»]
2DM8NMR-A1425-1527[»]
2DMZNMR-A355-470[»]
2EHRNMR-A1058-1167[»]
4Q2NX-ray2.00A/B/C/D/E/F362-452[»]
ProteinModelPortaliQ8NI35.
SMRiQ8NI35.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115502. 36 interactors.
IntActiQ8NI35. 35 interactors.
MINTiMINT-237883.
STRINGi9606.ENSP00000360200.

PTM databases

iPTMnetiQ8NI35.
PhosphoSitePlusiQ8NI35.

Polymorphism and mutation databases

BioMutaiINADL.
DMDMi116242542.

Proteomic databases

EPDiQ8NI35.
MaxQBiQ8NI35.
PaxDbiQ8NI35.
PeptideAtlasiQ8NI35.
PRIDEiQ8NI35.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371158; ENSP00000360200; ENSG00000132849. [Q8NI35-1]
ENST00000484937; ENSP00000433669; ENSG00000132849. [Q8NI35-5]
GeneIDi10207.
KEGGihsa:10207.
UCSCiuc001dab.4. human. [Q8NI35-1]

Organism-specific databases

CTDi10207.
DisGeNETi10207.
GeneCardsiINADL.
HGNCiHGNC:28881. PATJ.
HPAiHPA066352.
MIMi603199. gene.
neXtProtiNX_Q8NI35.
OpenTargetsiENSG00000132849.
PharmGKBiPA134919267.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0708. Eukaryota.
KOG3528. Eukaryota.
ENOG4110362. LUCA.
GeneTreeiENSGT00760000119017.
HOVERGENiHBG080134.
InParanoidiQ8NI35.
KOiK06092.
OMAiEAWEMHE.
OrthoDBiEOG091G0P7K.
PhylomeDBiQ8NI35.
TreeFamiTF330709.

Enzyme and pathway databases

ReactomeiR-HSA-420029. Tight junction interactions.
SignaLinkiQ8NI35.
SIGNORiQ8NI35.

Miscellaneous databases

ChiTaRSiINADL. human.
EvolutionaryTraceiQ8NI35.
GeneWikiiINADL.
GenomeRNAii10207.
PROiQ8NI35.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000132849.
ExpressionAtlasiQ8NI35. baseline and differential.
GenevisibleiQ8NI35. HS.

Family and domain databases

Gene3Di2.30.42.10. 10 hits.
InterProiIPR015132. L27_2.
IPR004172. L27_dom.
IPR001478. PDZ.
[Graphical view]
PfamiPF09045. L27_2. 1 hit.
PF00595. PDZ. 9 hits.
[Graphical view]
SMARTiSM00569. L27. 1 hit.
SM00228. PDZ. 10 hits.
[Graphical view]
SUPFAMiSSF101288. SSF101288. 1 hit.
SSF50156. SSF50156. 10 hits.
PROSITEiPS51022. L27. 1 hit.
PS50106. PDZ. 10 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiINADL_HUMAN
AccessioniPrimary (citable) accession number: Q8NI35
Secondary accession number(s): O15249
, O43742, O60833, Q5VUA5, Q5VUA6, Q5VUA7, Q5VUA8, Q5VUA9, Q5VUB0, Q8WU78, Q9H3N9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: October 17, 2006
Last modified: November 2, 2016
This is version 134 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.