Q8NI17 (IL31R_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Interleukin-31 receptor subunit alpha Short name=IL-31 receptor subunit alpha Short name=IL-31R subunit alpha Short name=IL-31R-alpha Short name=IL-31RA Alternative name(s): Cytokine receptor-like 3 GLM-R Short name=hGLM-R Gp130-like monocyte receptor Short name=Gp130-like receptor ZcytoR17 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 732 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Associates with OSMR to form the interleukin-31 receptor which activates STAT3 and to a lower extent STAT1 and STAT5. May function in skin immunity. Ref.1 Ref.2 Ref.8 Ref.9 Ref.10 |
| Subunit structure | Heterodimer with OSMR. Interacts with JAK1 and STAT3. Ref.2 Ref.10 |
| Subcellular location | Cell membrane; Single-pass type I membrane protein Probable. |
| Tissue specificity | Expressed at low levels in testis, ovary, brain, prostate, placenta, thymus, bone marrow, trachea and skin. Detected in all of the myelomonocytic lineage. Expressed in CD14- and CD56-positive blood cells and by macrophages (at protein level). Ref.1 Ref.2 Ref.8 Ref.11 |
| Induction | Up-regulated in lesional keratinocytes of patients with atopic dermatitis. Up-regulated by IFNG/IFN-gamma and bacterial lipopolysaccharides (LPS). Ref.1 Ref.2 Ref.8 Ref.11 |
| Post-translational modification | N-glycosylated. Ref.8 |
| Involvement in disease | Amyloidosis, primary localized cutaneous, 2 (PLCA2) [MIM:613955]: A primary amyloidosis characterized by localized cutaneous amyloid deposition. This condition usually presents with itching (especially on the lower legs) and visible changes of skin hyperpigmentation and thickening that may be exacerbated by chronic scratching and rubbing. Primary localized cutaneous amyloidosis is often divided into macular and lichen subtypes although many affected individuals often show both variants coexisting. Lichen amyloidosis characteristically presents as a pruritic eruption of grouped hyperkeratotic papules with a predilection for the shins, calves, ankles and dorsa of feet and thighs. Papules may coalesce to form hyperkeratotic plaques that can resemble lichen planus, lichen simplex or nodular prurigo. Macular amyloidosis is characterized by small pigmented macules that may merge to produce macular hyperpigmentation, sometimes with a reticulate or rippled pattern. In macular and lichen amyloidosis, amyloid is deposited in the papillary dermis in association with grouped colloid bodies, thought to represent degenerate basal keratinocytes. The amyloid deposits probably reflect a combination of degenerate keratin filaments, serum amyloid P component, and deposition of immunoglobulins. |
| Sequence similarities | Belongs to the type I cytokine receptor family. Type 2 subfamily. Contains 5 fibronectin type-III domains. |
| Sequence caution | The sequence AAS86444.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAS86445.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 12 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NI17-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NI17-2) Also known as: v3; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM | ||||||
| Isoform 3 (identifier: Q8NI17-3) Also known as: v4; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKLSPQPSCVNLGM 639-649: YVTCPFRPDCP → TRILSSCPTSI 650-732: Missing. | ||||||
| Isoform 4 (identifier: Q8NI17-4) Also known as: v2; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM 325-732: Missing. | ||||||
| Isoform 5 (identifier: Q8NI17-5) Also known as: v1; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM 639-649: YVTCPFRPDCP → TRILSSCPTSI 650-732: Missing. | ||||||
| Isoform 6 (identifier: Q8NI17-6) The sequence of this isoform differs from the canonical sequence as follows: 1-110: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q8NI17-7) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKLSPQPSCVNLGM 464-469: GGKGFS → A 498-501: TSAG → YSGG 502-732: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 8 (identifier: Q8NI17-8) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM 469-550: SKTVNSSILQ...YGLKKPNKLT → CKHAHSEVEK...RVLRKWKELL 551-732: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 9 (identifier: Q8NI17-9) Also known as: GPL560; short; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKLSPQPSCVNLGM 548-732: Missing. | ||||||
| Note: Major isoform. Dominant negative IL31 receptor. | ||||||
| Isoform 10 (identifier: Q8NI17-10) Also known as: GPL610; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKLSPQPSCVNLGM 593-598: LKPCST → RARYQA 599-732: Missing. | ||||||
| Isoform 11 (identifier: Q8NI17-11) Also known as: GPL626; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKLSPQPSCVNLGM 593-613: LKPCSTPSDKLVIDKLVVNFG → KGSELGTKLKFKPLISLDCAF 614-732: Missing. | ||||||
| Isoform 12 (identifier: Q8NI17-12) Also known as: GPL745; long; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MKLSPQPSCVNLGM | ||||||
| Note: Major isoform. Functional IL31 receptor. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 19 | 19 | Ref.7 | ||||||
| Chain | 20 – 732 | 713 | Interleukin-31 receptor subunit alpha | PRO_0000274572 | |||||
Regions | |||||||||
| Topological domain | 20 – 519 | 500 | Extracellular Potential | ||||||
| Transmembrane | 520 – 540 | 21 | Helical; Potential | ||||||
| Topological domain | 541 – 732 | 192 | Cytoplasmic Potential | ||||||
| Domain | 22 – 116 | 95 | Fibronectin type-III 1 | ||||||
| Domain | 121 – 222 | 102 | Fibronectin type-III 2 | ||||||
| Domain | 223 – 315 | 93 | Fibronectin type-III 3 | ||||||
| Domain | 319 – 416 | 98 | Fibronectin type-III 4 | ||||||
| Domain | 421 – 512 | 92 | Fibronectin type-III 5 | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 37 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 67 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 93 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 166 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 187 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 277 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 283 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 395 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 455 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 504 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 110 | 110 | Missing in isoform 6. | VSP_022798 | |||||
| Alternative sequence | 1 | 1 | M → MCIRQLKFFTTACVCECPQN ILSPQPSCVNLGM in isoform 2, isoform 4, isoform 5 and isoform 8. | VSP_022799 | |||||
| Alternative sequence | 1 | 1 | M → MKLSPQPSCVNLGM in isoform 3, isoform 7, isoform 9, isoform 10, isoform 11 and isoform 12. | VSP_022800 | |||||
| Alternative sequence | 325 – 732 | 408 | Missing in isoform 4. | VSP_022801 | |||||
| Alternative sequence | 464 – 469 | 6 | GGKGFS → A in isoform 7. | VSP_022802 | |||||
| Alternative sequence | 469 – 550 | 82 | SKTVN…PNKLT → CKHAHSEVEKNPKPQIDAMD RPVVGMAPPSHCDLQPGMNH LASLNLSENGAKSTHLLGFW GLNESEVTVPERRVLRKWKE LL in isoform 8. | VSP_022803 | |||||
| Alternative sequence | 498 – 501 | 4 | TSAG → YSGG in isoform 7. | VSP_022804 | |||||
| Alternative sequence | 502 – 732 | 231 | Missing in isoform 7. | VSP_022805 | |||||
| Alternative sequence | 548 – 732 | 185 | Missing in isoform 9. | VSP_022806 | |||||
| Alternative sequence | 551 – 732 | 182 | Missing in isoform 8. | VSP_022807 | |||||
| Alternative sequence | 593 – 613 | 21 | LKPCS…VVNFG → KGSELGTKLKFKPLISLDCA F in isoform 11. | VSP_022808 | |||||
| Alternative sequence | 593 – 598 | 6 | LKPCST → RARYQA in isoform 10. | VSP_022809 | |||||
| Alternative sequence | 599 – 732 | 134 | Missing in isoform 10. | VSP_022810 | |||||
| Alternative sequence | 614 – 732 | 119 | Missing in isoform 11. | VSP_022811 | |||||
| Alternative sequence | 639 – 649 | 11 | YVTCPFRPDCP → TRILSSCPTSI in isoform 3 and isoform 5. | VSP_022812 | |||||
| Alternative sequence | 650 – 732 | 83 | Missing in isoform 3 and isoform 5. | VSP_022813 | |||||
| Natural variant | 155 | 1 | D → N. Corresponds to variant rs13184107 [ dbSNP | Ensembl ]. | VAR_030328 | |||||
| Natural variant | 489 | 1 | S → F in PLCA2. Ref.12 | VAR_065809 | |||||
| Natural variant | 497 | 1 | S → N. Corresponds to variant rs161704 [ dbSNP | Ensembl ]. | VAR_030329 | |||||
Experimental info | |||||||||
| Mutagenesis | 639 | 1 | Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-670 and A-708. Ref.9 Ref.10 | ||||||
| Mutagenesis | 639 | 1 | Y → F: Abrogates STAT5 activation. Mild effect on STAT1 activation. No effect on STAT3 activation. Ref.9 Ref.10 | ||||||
| Mutagenesis | 670 | 1 | Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-708. Ref.9 Ref.10 | ||||||
| Mutagenesis | 670 | 1 | Y → F: No effect on STAT3 and STAT5 activation. Mild effect on STAT1 activation. Ref.9 Ref.10 | ||||||
| Mutagenesis | 708 | 1 | Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-670. Ref.9 Ref.10 | ||||||
| Mutagenesis | 708 | 1 | Y → F: Abrogates STAT3 activation. Loss of interaction with STAT3. Mild effect on STAT1 activation. No effect on STAT5 activation. Ref.9 Ref.10 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel type I cytokine receptor is expressed on monocytes, signals proliferation, and activates STAT-3 and STAT-5." Ghilardi N., Li J., Hongo J.-A., Yi S., Gurney A., De Sauvage F.J. J. Biol. Chem. 277:16831-16836(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, INDUCTION. |
| [2] | "Interleukin 31, a cytokine produced by activated T cells, induces dermatitis in mice." Dillon S.R., Sprecher C., Hammond A., Bilsborough J., Rosenfeld-Franklin M., Presnell S.R., Haugen H.S., Maurer M., Harder B., Johnston J., Bort S., Mudri S., Kuijper J.L., Bukowski T., Shea P., Dong D.L., Dasovich M., Grant F.J. Gross J.A.Nat. Immunol. 5:752-760(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4 AND 5), FUNCTION, OLIGOMERIZATION, TISSUE SPECIFICITY, INDUCTION. |
| [3] | "A novel soluble type 1 cytokine receptor." Zhang W., Wan T., He L., Yuan Z., Cao X. Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7). |
| [4] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 8). |
| [5] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). |
| [7] | "Signal peptide prediction based on analysis of experimentally verified cleavage sites." Zhang Z., Henzel W.J. Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF 20-34. |
| [8] | "GPL, a novel cytokine receptor related to GP130 and leukemia inhibitory factor receptor." Diveu C., Lelievre E., Perret D., Lagrue Lak-Hal A.-H., Froger J., Guillet C., Chevalier S., Rousseau F., Wesa A., Preisser L., Chabbert M., Gauchat J.-F., Galy A., Gascan H., Morel A. J. Biol. Chem. 278:49850-49859(2003) [PubMed] [Europe PMC] [Abstract] Cited for: ALTERNATIVE SPLICING (ISOFORMS 9; 10; 11 AND 12), FUNCTION, TISSUE SPECIFICITY, INDUCTION, GLYCOSYLATION. |
| [9] | "Predominant expression of the long isoform of GP130-like (GPL) receptor is required for interleukin-31 signaling." Diveu C., Lagrue Lak-Hal A.-H., Froger J., Ravon E., Grimaud L., Barbier F., Hermann J., Gascan H., Chevalier S. Eur. Cytokine Netw. 15:291-302(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF TYR-639; TYR-670 AND TYR-708. |
| [10] | "Characterization of the signaling capacities of the novel gp130-like cytokine receptor." Dreuw A., Radtke S., Pflanz S., Lippok B.E., Heinrich P.C., Hermanns H.M. J. Biol. Chem. 279:36112-36120(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH JAK1 AND STAT3, MUTAGENESIS OF TYR-639; TYR-670 AND TYR-708. |
| [11] | "IL-31 is associated with cutaneous lymphocyte antigen-positive skin homing T cells in patients with atopic dermatitis." Bilsborough J., Leung D.Y.M., Maurer M., Howell M., Boguniewicz M., Yao L., Storey H., LeCiel C., Harder B., Gross J.A. J. Allergy Clin. Immunol. 117:418-425(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION, TISSUE SPECIFICITY. |
| [12] | "Novel IL31RA gene mutation and ancestral OSMR mutant allele in familial primary cutaneous amyloidosis." Lin M.W., Lee D.D., Liu T.T., Lin Y.F., Chen S.Y., Huang C.C., Weng H.Y., Liu Y.F., Tanaka A., Arita K., Lai-Cheong J., Palisson F., Chang Y.T., Wong C.K., Matsuura I., McGrath J.A., Tsai S.F. Eur. J. Hum. Genet. 18:26-32(2010) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT PLCA2 PHE-489. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF486620 mRNA. Translation: AAM27958.1. AY499339 mRNA. Translation: AAS86444.1. Different initiation. AY499340 mRNA. Translation: AAS86445.1. Different initiation. AY499341 mRNA. Translation: AAS86446.1. AY499342 mRNA. Translation: AAS86447.1. AF106913 mRNA. Translation: AAL36452.1. AY358117 mRNA. Translation: AAQ88484.1. AY358740 mRNA. Translation: AAQ89100.1. AC008914 Genomic DNA. No translation available. BC110490 mRNA. Translation: AAI10491.1. |
| IPI | IPI00465082. IPI00478188. IPI00827493. IPI00827666. IPI00827821. IPI00827852. IPI00827904. IPI00827945. IPI00827997. IPI00828071. IPI00828090. IPI00828127. |
| RefSeq | NP_001229565.1. NM_001242636.1. NP_001229566.1. NM_001242637.1. NP_001229567.1. NM_001242638.1. NP_001229568.1. NM_001242639.1. NP_620586.3. NM_139017.5. |
| UniGene | Hs.55378. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1BQU based on UniProtKB P40189. |
| ProteinModelPortal | Q8NI17. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8NI17. |
Polymorphism databases | |
| DMDM | 74730327. |
Proteomic databases | |
| PaxDb | Q8NI17. |
| PRIDE | Q8NI17. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000354961; ENSP00000347047; ENSG00000164509. ENST00000359040; ENSP00000351935; ENSG00000164509. ENST00000396834; ENSP00000380046; ENSG00000164509. ENST00000396836; ENSP00000380048; ENSG00000164509. ENST00000447346; ENSP00000415900; ENSG00000164509. ENST00000490985; ENSP00000427533; ENSG00000164509. |
| GeneID | 133396. |
| KEGG | hsa:133396. |
| UCSC | uc003jqk.3. human. uc003jql.3. human. uc003jqm.3. human. uc003jqn.3. human. uc003jqo.3. human. uc021xyq.1. human. |
Organism-specific databases | |
| CTD | 133396. |
| GeneCards | GC05P055185. |
| HGNC | HGNC:18969. IL31RA. |
| MIM | 609510. gene. 613955. phenotype. |
| neXtProt | NX_Q8NI17. |
| Orphanet | 49804. Lichen amyloidosis. |
| PharmGKB | PA134952624. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG72763. |
| HOVERGEN | HBG081788. |
| InParanoid | Q8NI17. |
| OMA | DTWMVEW. |
Gene expression databases | |
| Bgee | Q8NI17. |
| Genevestigator | Q8NI17. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 3 hits. |
| InterPro | IPR003961. Fibronectin_type3. IPR013783. Ig-like_fold. IPR015321. IL6_recept-bd. [Graphical view] |
| Pfam | PF00041. fn3. 2 hits. PF09240. IL6Ra-bind. 1 hit. [Graphical view] |
| SMART | SM00060. FN3. 4 hits. [Graphical view] |
| SUPFAM | SSF49265. FN_III-like. 4 hits. |
| PROSITE | PS50853. FN3. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | IL31RA. human. |
| GenomeRNAi | 133396. |
| NextBio | 83210. |
| SOURCE | Search... |
Entry information
| Entry name | IL31R_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NI17 Secondary accession number(s): A6NIF8 Q8WYJ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
