SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NI17

- IL31R_HUMAN

UniProt

Q8NI17 - IL31R_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Interleukin-31 receptor subunit alpha

Gene
IL31RA, CRL3, GPL, UNQ6368/PRO21073/PRO21384
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Associates with OSMR to form the interleukin-31 receptor which activates STAT3 and to a lower extent STAT1 and STAT5. May function in skin immunity.5 Publications

GO - Molecular functioni

  1. cytokine binding Source: UniProtKB
  2. cytokine receptor activity Source: UniProtKB
  3. protein kinase binding Source: UniProtKB
  4. transcription coactivator activity Source: UniProtKB

GO - Biological processi

  1. cytokine-mediated signaling pathway Source: UniProtKB
  2. defense response Source: UniProtKB
  3. homeostatic process Source: UniProtKB
  4. JAK-STAT cascade Source: UniProtKB
  5. macrophage differentiation Source: UniProtKB
  6. MAPK cascade Source: UniProtKB
  7. monocyte differentiation Source: UniProtKB
  8. negative regulation of apoptotic process Source: UniProtKB
  9. negative regulation of macrophage activation Source: UniProtKB
  10. positive regulation of cell proliferation Source: UniProtKB
  11. positive regulation of transcription, DNA-templated Source: UniProtKB
  12. positive regulation of tyrosine phosphorylation of Stat3 protein Source: UniProtKB
  13. positive regulation of tyrosine phosphorylation of Stat5 protein Source: UniProtKB
  14. transmembrane receptor protein tyrosine kinase signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Immunity

Enzyme and pathway databases

SignaLinkiQ8NI17.

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-31 receptor subunit alpha
Short name:
IL-31 receptor subunit alpha
Short name:
IL-31R subunit alpha
Short name:
IL-31R-alpha
Short name:
IL-31RA
Alternative name(s):
Cytokine receptor-like 3
GLM-R
Short name:
hGLM-R
Gp130-like monocyte receptor
Short name:
Gp130-like receptor
ZcytoR17
Gene namesi
Name:IL31RA
Synonyms:CRL3, GPL
ORF Names:UNQ6368/PRO21073/PRO21384
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:18969. IL31RA.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini20 – 519500Extracellular Reviewed predictionAdd
BLAST
Transmembranei520 – 54021Helical; Reviewed predictionAdd
BLAST
Topological domaini541 – 732192Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Amyloidosis, primary localized cutaneous, 2 (PLCA2) [MIM:613955]: A primary amyloidosis characterized by localized cutaneous amyloid deposition. This condition usually presents with itching (especially on the lower legs) and visible changes of skin hyperpigmentation and thickening that may be exacerbated by chronic scratching and rubbing. Primary localized cutaneous amyloidosis is often divided into macular and lichen subtypes although many affected individuals often show both variants coexisting. Lichen amyloidosis characteristically presents as a pruritic eruption of grouped hyperkeratotic papules with a predilection for the shins, calves, ankles and dorsa of feet and thighs. Papules may coalesce to form hyperkeratotic plaques that can resemble lichen planus, lichen simplex or nodular prurigo. Macular amyloidosis is characterized by small pigmented macules that may merge to produce macular hyperpigmentation, sometimes with a reticulate or rippled pattern. In macular and lichen amyloidosis, amyloid is deposited in the papillary dermis in association with grouped colloid bodies, thought to represent degenerate basal keratinocytes. The amyloid deposits probably reflect a combination of degenerate keratin filaments, serum amyloid P component, and deposition of immunoglobulins.
Note: The disease is caused by mutations affecting the gene represented in this entry.1 Publication
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti489 – 4891S → F in PLCA2. 1 Publication
VAR_065809

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi639 – 6391Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-670 and A-708. 2 Publications
Mutagenesisi639 – 6391Y → F: Abrogates STAT5 activation. Mild effect on STAT1 activation. No effect on STAT3 activation. 2 Publications
Mutagenesisi670 – 6701Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-708. 2 Publications
Mutagenesisi670 – 6701Y → F: No effect on STAT3 and STAT5 activation. Mild effect on STAT1 activation. 2 Publications
Mutagenesisi708 – 7081Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-670. 2 Publications
Mutagenesisi708 – 7081Y → F: Abrogates STAT3 activation. Loss of interaction with STAT3. Mild effect on STAT1 activation. No effect on STAT5 activation. 2 Publications

Keywords - Diseasei

Amyloidosis, Disease mutation

Organism-specific databases

MIMi613955. phenotype.
Orphaneti353220. Familial primary localized cutaneous amyloidosis.
PharmGKBiPA134952624.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 19191 PublicationAdd
BLAST
Chaini20 – 732713Interleukin-31 receptor subunit alphaPRO_0000274572Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi37 – 371N-linked (GlcNAc...) Reviewed prediction
Glycosylationi67 – 671N-linked (GlcNAc...) Reviewed prediction
Glycosylationi93 – 931N-linked (GlcNAc...) Reviewed prediction
Glycosylationi166 – 1661N-linked (GlcNAc...) Reviewed prediction
Glycosylationi187 – 1871N-linked (GlcNAc...) Reviewed prediction
Glycosylationi277 – 2771N-linked (GlcNAc...) Reviewed prediction
Glycosylationi283 – 2831N-linked (GlcNAc...) Reviewed prediction
Glycosylationi395 – 3951N-linked (GlcNAc...) Reviewed prediction
Glycosylationi455 – 4551N-linked (GlcNAc...) Reviewed prediction
Glycosylationi504 – 5041N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

N-glycosylated.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ8NI17.
PaxDbiQ8NI17.
PRIDEiQ8NI17.

PTM databases

PhosphoSiteiQ8NI17.

Expressioni

Tissue specificityi

Expressed at low levels in testis, ovary, brain, prostate, placenta, thymus, bone marrow, trachea and skin. Detected in all of the myelomonocytic lineage. Expressed in CD14- and CD56-positive blood cells and by macrophages (at protein level).4 Publications

Inductioni

Up-regulated in lesional keratinocytes of patients with atopic dermatitis. Up-regulated by IFNG/IFN-gamma and bacterial lipopolysaccharides (LPS).4 Publications

Gene expression databases

ArrayExpressiQ8NI17.
BgeeiQ8NI17.
GenevestigatoriQ8NI17.

Interactioni

Subunit structurei

Heterodimer with OSMR. Interacts with JAK1 and STAT3.2 Publications

Structurei

3D structure databases

ProteinModelPortaliQ8NI17.
SMRiQ8NI17. Positions 22-227, 237-512.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini24 – 12299Fibronectin type-III 1Add
BLAST
Domaini124 – 225102Fibronectin type-III 2Add
BLAST
Domaini223 – 31593Fibronectin type-III 3Add
BLAST
Domaini319 – 41698Fibronectin type-III 4Add
BLAST
Domaini421 – 51595Fibronectin type-III 5Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG72763.
HOVERGENiHBG081788.
InParanoidiQ8NI17.
OMAiWGLNESE.
OrthoDBiEOG7FXZXN.
PhylomeDBiQ8NI17.
TreeFamiTF338122.

Family and domain databases

Gene3Di2.60.40.10. 3 hits.
InterProiIPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR015321. IL-6_rcpt_alpha-bd.
[Graphical view]
PfamiPF00041. fn3. 2 hits.
PF09240. IL6Ra-bind. 1 hit.
[Graphical view]
SMARTiSM00060. FN3. 4 hits.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 3 hits.
PROSITEiPS50853. FN3. 3 hits.
[Graphical view]

Sequences (12)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 12 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8NI17-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MMWTWALWML PSLCKFSLAA LPAKPENISC VYYYRKNLTC TWSPGKETSY    50
TQYTVKRTYA FGEKHDNCTT NSSTSENRAS CSFFLPRITI PDNYTIEVEA 100
ENGDGVIKSH MTYWRLENIA KTEPPKIFRV KPVLGIKRMI QIEWIKPELA 150
PVSSDLKYTL RFRTVNSTSW MEVNFAKNRK DKNQTYNLTG LQPFTEYVIA 200
LRCAVKESKF WSDWSQEKMG MTEEEAPCGL ELWRVLKPAE ADGRRPVRLL 250
WKKARGAPVL EKTLGYNIWY YPESNTNLTE TMNTTNQQLE LHLGGESFWV 300
SMISYNSLGK SPVATLRIPA IQEKSFQCIE VMQACVAEDQ LVVKWQSSAL 350
DVNTWMIEWF PDVDSEPTTL SWESVSQATN WTIQQDKLKP FWCYNISVYP 400
MLHDKVGEPY SIQAYAKEGV PSEGPETKVE NIGVKTVTIT WKEIPKSERK 450
GIICNYTIFY QAEGGKGFSK TVNSSILQYG LESLKRKTSY IVQVMASTSA 500
GGTNGTSINF KTLSFSVFEI ILITSLIGGG LLILIILTVA YGLKKPNKLT 550
HLCWPTVPNP AESSIATWHG DDFKDKLNLK ESDDSVNTED RILKPCSTPS 600
DKLVIDKLVV NFGNVLQEIF TDEARTGQEN NLGGEKNGYV TCPFRPDCPL 650
GKSFEELPVS PEIPPRKSQY LRSRMPEGTR PEAKEQLLFS GQSLVPDHLC 700
EEGAPNPYLK NSVTAREFLV SEKLPEHTKG EV 732
Length:732
Mass (Da):82,954
Last modified:October 1, 2002 - v1
Checksum:i30F84BD3DD99A20E
GO
Isoform 2 (identifier: Q8NI17-2) [UniParc]FASTAAdd to Basket

Also known as: v3

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM

Show »
Length:764
Mass (Da):86,481
Checksum:iDC1D6BB2EA6AF15F
GO
Isoform 3 (identifier: Q8NI17-3) [UniParc]FASTAAdd to Basket

Also known as: v4

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     639-649: YVTCPFRPDCP → TRILSSCPTSI
     650-732: Missing.

Show »
Length:662
Mass (Da):74,876
Checksum:iA49F6363C4B33582
GO
Isoform 4 (identifier: Q8NI17-4) [UniParc]FASTAAdd to Basket

Also known as: v2

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     325-732: Missing.

Show »
Length:356
Mass (Da):41,026
Checksum:iBF4DAD24F5048E1D
GO
Isoform 5 (identifier: Q8NI17-5) [UniParc]FASTAAdd to Basket

Also known as: v1

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     639-649: YVTCPFRPDCP → TRILSSCPTSI
     650-732: Missing.

Show »
Length:681
Mass (Da):77,047
Checksum:iC69CC4EF9AC55E42
GO
Isoform 6 (identifier: Q8NI17-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-110: Missing.

Note: No experimental confirmation available.

Show »
Length:622
Mass (Da):70,363
Checksum:i80E4A3592D040EC6
GO
Isoform 7 (identifier: Q8NI17-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     464-469: GGKGFS → A
     498-501: TSAG → YSGG
     502-732: Missing.

Note: No experimental confirmation available.

Show »
Length:509
Mass (Da):58,390
Checksum:i5DC85C59E170D44B
GO
Isoform 8 (identifier: Q8NI17-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     469-550: SKTVNSSILQ...YGLKKPNKLT → CKHAHSEVEK...RVLRKWKELL
     551-732: Missing.

Note: No experimental confirmation available.

Show »
Length:582
Mass (Da):66,605
Checksum:i5EC7B07B84B36057
GO
Isoform 9 (identifier: Q8NI17-9) [UniParc]FASTAAdd to Basket

Also known as: GPL560, short

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     548-732: Missing.

Note: Major isoform. Dominant negative IL31 receptor.

Show »
Length:560
Mass (Da):63,638
Checksum:iBDE67D9F753AED29
GO
Isoform 10 (identifier: Q8NI17-10) [UniParc]FASTAAdd to Basket

Also known as: GPL610

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     593-598: LKPCST → RARYQA
     599-732: Missing.

Show »
Length:611
Mass (Da):69,491
Checksum:iEE437BBA84162525
GO
Isoform 11 (identifier: Q8NI17-11) [UniParc]FASTAAdd to Basket

Also known as: GPL626

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     593-613: LKPCSTPSDKLVIDKLVVNFG → KGSELGTKLKFKPLISLDCAF
     614-732: Missing.

Show »
Length:626
Mass (Da):71,023
Checksum:iFA80DED660647A2F
GO
Isoform 12 (identifier: Q8NI17-12) [UniParc]FASTAAdd to Basket

Also known as: GPL745, long

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM

Note: Major isoform. Functional IL31 receptor.

Show »
Length:745
Mass (Da):84,309
Checksum:iC4A17642CCC0549B
GO

Sequence cautioni

The sequence AAS86444.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence AAS86445.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti155 – 1551D → N.
Corresponds to variant rs13184107 [ dbSNP | Ensembl ].
VAR_030328
Natural varianti489 – 4891S → F in PLCA2. 1 Publication
VAR_065809
Natural varianti497 – 4971S → N.
Corresponds to variant rs161704 [ dbSNP | Ensembl ].
VAR_030329

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 110110Missing in isoform 6. VSP_022798Add
BLAST
Alternative sequencei1 – 11M → MCIRQLKFFTTACVCECPQN ILSPQPSCVNLGM in isoform 2, isoform 4, isoform 5 and isoform 8. VSP_022799
Alternative sequencei1 – 11M → MKLSPQPSCVNLGM in isoform 3, isoform 7, isoform 9, isoform 10, isoform 11 and isoform 12. VSP_022800
Alternative sequencei325 – 732408Missing in isoform 4. VSP_022801Add
BLAST
Alternative sequencei464 – 4696GGKGFS → A in isoform 7. VSP_022802
Alternative sequencei469 – 55082SKTVN…PNKLT → CKHAHSEVEKNPKPQIDAMD RPVVGMAPPSHCDLQPGMNH LASLNLSENGAKSTHLLGFW GLNESEVTVPERRVLRKWKE LL in isoform 8. VSP_022803Add
BLAST
Alternative sequencei498 – 5014TSAG → YSGG in isoform 7. VSP_022804
Alternative sequencei502 – 732231Missing in isoform 7. VSP_022805Add
BLAST
Alternative sequencei548 – 732185Missing in isoform 9. VSP_022806Add
BLAST
Alternative sequencei551 – 732182Missing in isoform 8. VSP_022807Add
BLAST
Alternative sequencei593 – 61321LKPCS…VVNFG → KGSELGTKLKFKPLISLDCA F in isoform 11. VSP_022808Add
BLAST
Alternative sequencei593 – 5986LKPCST → RARYQA in isoform 10. VSP_022809
Alternative sequencei599 – 732134Missing in isoform 10. VSP_022810Add
BLAST
Alternative sequencei614 – 732119Missing in isoform 11. VSP_022811Add
BLAST
Alternative sequencei639 – 64911YVTCPFRPDCP → TRILSSCPTSI in isoform 3 and isoform 5. VSP_022812Add
BLAST
Alternative sequencei650 – 73283Missing in isoform 3 and isoform 5. VSP_022813Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF486620 mRNA. Translation: AAM27958.1.
AY499339 mRNA. Translation: AAS86444.1. Different initiation.
AY499340 mRNA. Translation: AAS86445.1. Different initiation.
AY499341 mRNA. Translation: AAS86446.1.
AY499342 mRNA. Translation: AAS86447.1.
AF106913 mRNA. Translation: AAL36452.1.
AY358117 mRNA. Translation: AAQ88484.1.
AY358740 mRNA. Translation: AAQ89100.1.
AC008914 Genomic DNA. No translation available.
BC110490 mRNA. Translation: AAI10491.1.
CCDSiCCDS3970.2. [Q8NI17-2]
CCDS56365.1. [Q8NI17-5]
CCDS56366.1. [Q8NI17-3]
CCDS56367.1. [Q8NI17-6]
RefSeqiNP_001229565.1. NM_001242636.1. [Q8NI17-12]
NP_001229566.1. NM_001242637.1. [Q8NI17-5]
NP_001229567.1. NM_001242638.1. [Q8NI17-3]
NP_001229568.1. NM_001242639.1. [Q8NI17-6]
NP_620586.3. NM_139017.5. [Q8NI17-2]
XP_005248485.1. XM_005248428.1. [Q8NI17-4]
XP_006714591.1. XM_006714528.1. [Q8NI17-8]
UniGeneiHs.55378.

Genome annotation databases

EnsembliENST00000354961; ENSP00000347047; ENSG00000164509. [Q8NI17-3]
ENST00000359040; ENSP00000351935; ENSG00000164509. [Q8NI17-5]
ENST00000396834; ENSP00000380046; ENSG00000164509. [Q8NI17-3]
ENST00000396836; ENSP00000380048; ENSG00000164509. [Q8NI17-8]
ENST00000447346; ENSP00000415900; ENSG00000164509. [Q8NI17-2]
ENST00000490985; ENSP00000427533; ENSG00000164509. [Q8NI17-6]
GeneIDi133396.
KEGGihsa:133396.
UCSCiuc003jqk.3. human. [Q8NI17-8]
uc003jql.3. human. [Q8NI17-2]
uc003jqm.3. human. [Q8NI17-3]
uc003jqn.3. human. [Q8NI17-5]
uc003jqo.3. human. [Q8NI17-1]
uc021xyq.1. human. [Q8NI17-12]

Polymorphism databases

DMDMi74730327.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF486620 mRNA. Translation: AAM27958.1 .
AY499339 mRNA. Translation: AAS86444.1 . Different initiation.
AY499340 mRNA. Translation: AAS86445.1 . Different initiation.
AY499341 mRNA. Translation: AAS86446.1 .
AY499342 mRNA. Translation: AAS86447.1 .
AF106913 mRNA. Translation: AAL36452.1 .
AY358117 mRNA. Translation: AAQ88484.1 .
AY358740 mRNA. Translation: AAQ89100.1 .
AC008914 Genomic DNA. No translation available.
BC110490 mRNA. Translation: AAI10491.1 .
CCDSi CCDS3970.2. [Q8NI17-2 ]
CCDS56365.1. [Q8NI17-5 ]
CCDS56366.1. [Q8NI17-3 ]
CCDS56367.1. [Q8NI17-6 ]
RefSeqi NP_001229565.1. NM_001242636.1. [Q8NI17-12 ]
NP_001229566.1. NM_001242637.1. [Q8NI17-5 ]
NP_001229567.1. NM_001242638.1. [Q8NI17-3 ]
NP_001229568.1. NM_001242639.1. [Q8NI17-6 ]
NP_620586.3. NM_139017.5. [Q8NI17-2 ]
XP_005248485.1. XM_005248428.1. [Q8NI17-4 ]
XP_006714591.1. XM_006714528.1. [Q8NI17-8 ]
UniGenei Hs.55378.

3D structure databases

ProteinModelPortali Q8NI17.
SMRi Q8NI17. Positions 22-227, 237-512.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q8NI17.

Polymorphism databases

DMDMi 74730327.

Proteomic databases

MaxQBi Q8NI17.
PaxDbi Q8NI17.
PRIDEi Q8NI17.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000354961 ; ENSP00000347047 ; ENSG00000164509 . [Q8NI17-3 ]
ENST00000359040 ; ENSP00000351935 ; ENSG00000164509 . [Q8NI17-5 ]
ENST00000396834 ; ENSP00000380046 ; ENSG00000164509 . [Q8NI17-3 ]
ENST00000396836 ; ENSP00000380048 ; ENSG00000164509 . [Q8NI17-8 ]
ENST00000447346 ; ENSP00000415900 ; ENSG00000164509 . [Q8NI17-2 ]
ENST00000490985 ; ENSP00000427533 ; ENSG00000164509 . [Q8NI17-6 ]
GeneIDi 133396.
KEGGi hsa:133396.
UCSCi uc003jqk.3. human. [Q8NI17-8 ]
uc003jql.3. human. [Q8NI17-2 ]
uc003jqm.3. human. [Q8NI17-3 ]
uc003jqn.3. human. [Q8NI17-5 ]
uc003jqo.3. human. [Q8NI17-1 ]
uc021xyq.1. human. [Q8NI17-12 ]

Organism-specific databases

CTDi 133396.
GeneCardsi GC05P055185.
HGNCi HGNC:18969. IL31RA.
MIMi 609510. gene.
613955. phenotype.
neXtProti NX_Q8NI17.
Orphaneti 353220. Familial primary localized cutaneous amyloidosis.
PharmGKBi PA134952624.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG72763.
HOVERGENi HBG081788.
InParanoidi Q8NI17.
OMAi WGLNESE.
OrthoDBi EOG7FXZXN.
PhylomeDBi Q8NI17.
TreeFami TF338122.

Enzyme and pathway databases

SignaLinki Q8NI17.

Miscellaneous databases

ChiTaRSi IL31RA. human.
GeneWikii IL31RA.
GenomeRNAii 133396.
NextBioi 83210.
PROi Q8NI17.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8NI17.
Bgeei Q8NI17.
Genevestigatori Q8NI17.

Family and domain databases

Gene3Di 2.60.40.10. 3 hits.
InterProi IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR015321. IL-6_rcpt_alpha-bd.
[Graphical view ]
Pfami PF00041. fn3. 2 hits.
PF09240. IL6Ra-bind. 1 hit.
[Graphical view ]
SMARTi SM00060. FN3. 4 hits.
[Graphical view ]
SUPFAMi SSF49265. SSF49265. 3 hits.
PROSITEi PS50853. FN3. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel type I cytokine receptor is expressed on monocytes, signals proliferation, and activates STAT-3 and STAT-5."
    Ghilardi N., Li J., Hongo J.-A., Yi S., Gurney A., De Sauvage F.J.
    J. Biol. Chem. 277:16831-16836(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, INDUCTION.
  2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4 AND 5), FUNCTION, OLIGOMERIZATION, TISSUE SPECIFICITY, INDUCTION.
  3. "A novel soluble type 1 cytokine receptor."
    Zhang W., Wan T., He L., Yuan Z., Cao X.
    Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 8).
  5. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
  7. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
    Zhang Z., Henzel W.J.
    Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE OF 20-34.
  8. Cited for: ALTERNATIVE SPLICING (ISOFORMS 9; 10; 11 AND 12), FUNCTION, TISSUE SPECIFICITY, INDUCTION, GLYCOSYLATION.
  9. "Predominant expression of the long isoform of GP130-like (GPL) receptor is required for interleukin-31 signaling."
    Diveu C., Lagrue Lak-Hal A.-H., Froger J., Ravon E., Grimaud L., Barbier F., Hermann J., Gascan H., Chevalier S.
    Eur. Cytokine Netw. 15:291-302(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, MUTAGENESIS OF TYR-639; TYR-670 AND TYR-708.
  10. "Characterization of the signaling capacities of the novel gp130-like cytokine receptor."
    Dreuw A., Radtke S., Pflanz S., Lippok B.E., Heinrich P.C., Hermanns H.M.
    J. Biol. Chem. 279:36112-36120(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH JAK1 AND STAT3, MUTAGENESIS OF TYR-639; TYR-670 AND TYR-708.
  11. "IL-31 is associated with cutaneous lymphocyte antigen-positive skin homing T cells in patients with atopic dermatitis."
    Bilsborough J., Leung D.Y.M., Maurer M., Howell M., Boguniewicz M., Yao L., Storey H., LeCiel C., Harder B., Gross J.A.
    J. Allergy Clin. Immunol. 117:418-425(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION, TISSUE SPECIFICITY.
  12. Cited for: VARIANT PLCA2 PHE-489.

Entry informationi

Entry nameiIL31R_HUMAN
AccessioniPrimary (citable) accession number: Q8NI17
Secondary accession number(s): A6NIF8
, Q2TBA1, Q6EBC3, Q6EBC4, Q6EBC5, Q6EBC6, Q6UWL8, Q8WYJ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: October 1, 2002
Last modified: July 9, 2014
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi