Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NI17

- IL31R_HUMAN

UniProt

Q8NI17 - IL31R_HUMAN

Protein

Interleukin-31 receptor subunit alpha

Gene

IL31RA

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 106 (01 Oct 2014)
      Sequence version 1 (01 Oct 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Associates with OSMR to form the interleukin-31 receptor which activates STAT3 and to a lower extent STAT1 and STAT5. May function in skin immunity.5 Publications

    GO - Molecular functioni

    1. cytokine binding Source: UniProtKB
    2. cytokine receptor activity Source: UniProtKB
    3. protein kinase binding Source: UniProtKB
    4. transcription coactivator activity Source: UniProtKB

    GO - Biological processi

    1. cytokine-mediated signaling pathway Source: UniProtKB
    2. defense response Source: UniProtKB
    3. homeostatic process Source: UniProtKB
    4. JAK-STAT cascade Source: UniProtKB
    5. macrophage differentiation Source: UniProtKB
    6. MAPK cascade Source: UniProtKB
    7. monocyte differentiation Source: UniProtKB
    8. negative regulation of apoptotic process Source: UniProtKB
    9. negative regulation of macrophage activation Source: UniProtKB
    10. positive regulation of cell proliferation Source: UniProtKB
    11. positive regulation of transcription, DNA-templated Source: UniProtKB
    12. positive regulation of tyrosine phosphorylation of Stat3 protein Source: UniProtKB
    13. positive regulation of tyrosine phosphorylation of Stat5 protein Source: UniProtKB
    14. transmembrane receptor protein tyrosine kinase signaling pathway Source: UniProtKB

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Immunity

    Enzyme and pathway databases

    SignaLinkiQ8NI17.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Interleukin-31 receptor subunit alpha
    Short name:
    IL-31 receptor subunit alpha
    Short name:
    IL-31R subunit alpha
    Short name:
    IL-31R-alpha
    Short name:
    IL-31RA
    Alternative name(s):
    Cytokine receptor-like 3
    GLM-R
    Short name:
    hGLM-R
    Gp130-like monocyte receptor
    Short name:
    Gp130-like receptor
    ZcytoR17
    Gene namesi
    Name:IL31RA
    Synonyms:CRL3, GPL
    ORF Names:UNQ6368/PRO21073/PRO21384
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:18969. IL31RA.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Amyloidosis, primary localized cutaneous, 2 (PLCA2) [MIM:613955]: A primary amyloidosis characterized by localized cutaneous amyloid deposition. This condition usually presents with itching (especially on the lower legs) and visible changes of skin hyperpigmentation and thickening that may be exacerbated by chronic scratching and rubbing. Primary localized cutaneous amyloidosis is often divided into macular and lichen subtypes although many affected individuals often show both variants coexisting. Lichen amyloidosis characteristically presents as a pruritic eruption of grouped hyperkeratotic papules with a predilection for the shins, calves, ankles and dorsa of feet and thighs. Papules may coalesce to form hyperkeratotic plaques that can resemble lichen planus, lichen simplex or nodular prurigo. Macular amyloidosis is characterized by small pigmented macules that may merge to produce macular hyperpigmentation, sometimes with a reticulate or rippled pattern. In macular and lichen amyloidosis, amyloid is deposited in the papillary dermis in association with grouped colloid bodies, thought to represent degenerate basal keratinocytes. The amyloid deposits probably reflect a combination of degenerate keratin filaments, serum amyloid P component, and deposition of immunoglobulins.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti489 – 4891S → F in PLCA2. 1 Publication
    VAR_065809

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi639 – 6391Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-670 and A-708. 2 Publications
    Mutagenesisi639 – 6391Y → F: Abrogates STAT5 activation. Mild effect on STAT1 activation. No effect on STAT3 activation. 2 Publications
    Mutagenesisi670 – 6701Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-708. 2 Publications
    Mutagenesisi670 – 6701Y → F: No effect on STAT3 and STAT5 activation. Mild effect on STAT1 activation. 2 Publications
    Mutagenesisi708 – 7081Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-670. 2 Publications
    Mutagenesisi708 – 7081Y → F: Abrogates STAT3 activation. Loss of interaction with STAT3. Mild effect on STAT1 activation. No effect on STAT5 activation. 2 Publications

    Keywords - Diseasei

    Amyloidosis, Disease mutation

    Organism-specific databases

    MIMi613955. phenotype.
    Orphaneti353220. Familial primary localized cutaneous amyloidosis.
    PharmGKBiPA134952624.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 19191 PublicationAdd
    BLAST
    Chaini20 – 732713Interleukin-31 receptor subunit alphaPRO_0000274572Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi37 – 371N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi67 – 671N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi93 – 931N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi166 – 1661N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi187 – 1871N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi277 – 2771N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi283 – 2831N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi395 – 3951N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi455 – 4551N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi504 – 5041N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    N-glycosylated.1 Publication

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ8NI17.
    PaxDbiQ8NI17.
    PRIDEiQ8NI17.

    PTM databases

    PhosphoSiteiQ8NI17.

    Expressioni

    Tissue specificityi

    Expressed at low levels in testis, ovary, brain, prostate, placenta, thymus, bone marrow, trachea and skin. Detected in all of the myelomonocytic lineage. Expressed in CD14- and CD56-positive blood cells and by macrophages (at protein level).4 Publications

    Inductioni

    Up-regulated in lesional keratinocytes of patients with atopic dermatitis. Up-regulated by IFNG/IFN-gamma and bacterial lipopolysaccharides (LPS).4 Publications

    Gene expression databases

    ArrayExpressiQ8NI17.
    BgeeiQ8NI17.
    GenevestigatoriQ8NI17.

    Interactioni

    Subunit structurei

    Heterodimer with OSMR. Interacts with JAK1 and STAT3.1 Publication

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NI17.
    SMRiQ8NI17. Positions 22-227, 237-512.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini20 – 519500ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini541 – 732192CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei520 – 54021HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini24 – 12299Fibronectin type-III 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini124 – 225102Fibronectin type-III 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini223 – 31593Fibronectin type-III 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini319 – 41698Fibronectin type-III 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini421 – 51595Fibronectin type-III 5PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 5 fibronectin type-III domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG72763.
    HOVERGENiHBG081788.
    InParanoidiQ8NI17.
    OMAiWGLNESE.
    OrthoDBiEOG7FXZXN.
    PhylomeDBiQ8NI17.
    TreeFamiTF338122.

    Family and domain databases

    Gene3Di2.60.40.10. 3 hits.
    InterProiIPR003961. Fibronectin_type3.
    IPR013783. Ig-like_fold.
    IPR015321. IL-6_rcpt_alpha-bd.
    [Graphical view]
    PfamiPF00041. fn3. 2 hits.
    PF09240. IL6Ra-bind. 1 hit.
    [Graphical view]
    SMARTiSM00060. FN3. 4 hits.
    [Graphical view]
    SUPFAMiSSF49265. SSF49265. 3 hits.
    PROSITEiPS50853. FN3. 3 hits.
    [Graphical view]

    Sequences (12)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 12 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NI17-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MMWTWALWML PSLCKFSLAA LPAKPENISC VYYYRKNLTC TWSPGKETSY    50
    TQYTVKRTYA FGEKHDNCTT NSSTSENRAS CSFFLPRITI PDNYTIEVEA 100
    ENGDGVIKSH MTYWRLENIA KTEPPKIFRV KPVLGIKRMI QIEWIKPELA 150
    PVSSDLKYTL RFRTVNSTSW MEVNFAKNRK DKNQTYNLTG LQPFTEYVIA 200
    LRCAVKESKF WSDWSQEKMG MTEEEAPCGL ELWRVLKPAE ADGRRPVRLL 250
    WKKARGAPVL EKTLGYNIWY YPESNTNLTE TMNTTNQQLE LHLGGESFWV 300
    SMISYNSLGK SPVATLRIPA IQEKSFQCIE VMQACVAEDQ LVVKWQSSAL 350
    DVNTWMIEWF PDVDSEPTTL SWESVSQATN WTIQQDKLKP FWCYNISVYP 400
    MLHDKVGEPY SIQAYAKEGV PSEGPETKVE NIGVKTVTIT WKEIPKSERK 450
    GIICNYTIFY QAEGGKGFSK TVNSSILQYG LESLKRKTSY IVQVMASTSA 500
    GGTNGTSINF KTLSFSVFEI ILITSLIGGG LLILIILTVA YGLKKPNKLT 550
    HLCWPTVPNP AESSIATWHG DDFKDKLNLK ESDDSVNTED RILKPCSTPS 600
    DKLVIDKLVV NFGNVLQEIF TDEARTGQEN NLGGEKNGYV TCPFRPDCPL 650
    GKSFEELPVS PEIPPRKSQY LRSRMPEGTR PEAKEQLLFS GQSLVPDHLC 700
    EEGAPNPYLK NSVTAREFLV SEKLPEHTKG EV 732
    Length:732
    Mass (Da):82,954
    Last modified:October 1, 2002 - v1
    Checksum:i30F84BD3DD99A20E
    GO
    Isoform 2 (identifier: Q8NI17-2) [UniParc]FASTAAdd to Basket

    Also known as: v3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM

    Show »
    Length:764
    Mass (Da):86,481
    Checksum:iDC1D6BB2EA6AF15F
    GO
    Isoform 3 (identifier: Q8NI17-3) [UniParc]FASTAAdd to Basket

    Also known as: v4

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MKLSPQPSCVNLGM
         639-649: YVTCPFRPDCP → TRILSSCPTSI
         650-732: Missing.

    Show »
    Length:662
    Mass (Da):74,876
    Checksum:iA49F6363C4B33582
    GO
    Isoform 4 (identifier: Q8NI17-4) [UniParc]FASTAAdd to Basket

    Also known as: v2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
         325-732: Missing.

    Show »
    Length:356
    Mass (Da):41,026
    Checksum:iBF4DAD24F5048E1D
    GO
    Isoform 5 (identifier: Q8NI17-5) [UniParc]FASTAAdd to Basket

    Also known as: v1

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
         639-649: YVTCPFRPDCP → TRILSSCPTSI
         650-732: Missing.

    Show »
    Length:681
    Mass (Da):77,047
    Checksum:iC69CC4EF9AC55E42
    GO
    Isoform 6 (identifier: Q8NI17-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-110: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:622
    Mass (Da):70,363
    Checksum:i80E4A3592D040EC6
    GO
    Isoform 7 (identifier: Q8NI17-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MKLSPQPSCVNLGM
         464-469: GGKGFS → A
         498-501: TSAG → YSGG
         502-732: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:509
    Mass (Da):58,390
    Checksum:i5DC85C59E170D44B
    GO
    Isoform 8 (identifier: Q8NI17-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
         469-550: SKTVNSSILQ...YGLKKPNKLT → CKHAHSEVEK...RVLRKWKELL
         551-732: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:582
    Mass (Da):66,605
    Checksum:i5EC7B07B84B36057
    GO
    Isoform 9 (identifier: Q8NI17-9) [UniParc]FASTAAdd to Basket

    Also known as: GPL560, short

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MKLSPQPSCVNLGM
         548-732: Missing.

    Note: Major isoform. Dominant negative IL31 receptor.

    Show »
    Length:560
    Mass (Da):63,638
    Checksum:iBDE67D9F753AED29
    GO
    Isoform 10 (identifier: Q8NI17-10) [UniParc]FASTAAdd to Basket

    Also known as: GPL610

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MKLSPQPSCVNLGM
         593-598: LKPCST → RARYQA
         599-732: Missing.

    Show »
    Length:611
    Mass (Da):69,491
    Checksum:iEE437BBA84162525
    GO
    Isoform 11 (identifier: Q8NI17-11) [UniParc]FASTAAdd to Basket

    Also known as: GPL626

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MKLSPQPSCVNLGM
         593-613: LKPCSTPSDKLVIDKLVVNFG → KGSELGTKLKFKPLISLDCAF
         614-732: Missing.

    Show »
    Length:626
    Mass (Da):71,023
    Checksum:iFA80DED660647A2F
    GO
    Isoform 12 (identifier: Q8NI17-12) [UniParc]FASTAAdd to Basket

    Also known as: GPL745, long

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MKLSPQPSCVNLGM

    Note: Major isoform. Functional IL31 receptor.

    Show »
    Length:745
    Mass (Da):84,309
    Checksum:iC4A17642CCC0549B
    GO

    Sequence cautioni

    The sequence AAS86444.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence AAS86445.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti155 – 1551D → N.
    Corresponds to variant rs13184107 [ dbSNP | Ensembl ].
    VAR_030328
    Natural varianti489 – 4891S → F in PLCA2. 1 Publication
    VAR_065809
    Natural varianti497 – 4971S → N.
    Corresponds to variant rs161704 [ dbSNP | Ensembl ].
    VAR_030329

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 110110Missing in isoform 6. 1 PublicationVSP_022798Add
    BLAST
    Alternative sequencei1 – 11M → MCIRQLKFFTTACVCECPQN ILSPQPSCVNLGM in isoform 2, isoform 4, isoform 5 and isoform 8. 2 PublicationsVSP_022799
    Alternative sequencei1 – 11M → MKLSPQPSCVNLGM in isoform 3, isoform 7, isoform 9, isoform 10, isoform 11 and isoform 12. 2 PublicationsVSP_022800
    Alternative sequencei325 – 732408Missing in isoform 4. 1 PublicationVSP_022801Add
    BLAST
    Alternative sequencei464 – 4696GGKGFS → A in isoform 7. 1 PublicationVSP_022802
    Alternative sequencei469 – 55082SKTVN…PNKLT → CKHAHSEVEKNPKPQIDAMD RPVVGMAPPSHCDLQPGMNH LASLNLSENGAKSTHLLGFW GLNESEVTVPERRVLRKWKE LL in isoform 8. 1 PublicationVSP_022803Add
    BLAST
    Alternative sequencei498 – 5014TSAG → YSGG in isoform 7. 1 PublicationVSP_022804
    Alternative sequencei502 – 732231Missing in isoform 7. 1 PublicationVSP_022805Add
    BLAST
    Alternative sequencei548 – 732185Missing in isoform 9. CuratedVSP_022806Add
    BLAST
    Alternative sequencei551 – 732182Missing in isoform 8. 1 PublicationVSP_022807Add
    BLAST
    Alternative sequencei593 – 61321LKPCS…VVNFG → KGSELGTKLKFKPLISLDCA F in isoform 11. CuratedVSP_022808Add
    BLAST
    Alternative sequencei593 – 5986LKPCST → RARYQA in isoform 10. CuratedVSP_022809
    Alternative sequencei599 – 732134Missing in isoform 10. CuratedVSP_022810Add
    BLAST
    Alternative sequencei614 – 732119Missing in isoform 11. CuratedVSP_022811Add
    BLAST
    Alternative sequencei639 – 64911YVTCPFRPDCP → TRILSSCPTSI in isoform 3 and isoform 5. 1 PublicationVSP_022812Add
    BLAST
    Alternative sequencei650 – 73283Missing in isoform 3 and isoform 5. 1 PublicationVSP_022813Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF486620 mRNA. Translation: AAM27958.1.
    AY499339 mRNA. Translation: AAS86444.1. Different initiation.
    AY499340 mRNA. Translation: AAS86445.1. Different initiation.
    AY499341 mRNA. Translation: AAS86446.1.
    AY499342 mRNA. Translation: AAS86447.1.
    AF106913 mRNA. Translation: AAL36452.1.
    AY358117 mRNA. Translation: AAQ88484.1.
    AY358740 mRNA. Translation: AAQ89100.1.
    AC008914 Genomic DNA. No translation available.
    BC110490 mRNA. Translation: AAI10491.1.
    CCDSiCCDS3970.2. [Q8NI17-2]
    CCDS56365.1. [Q8NI17-5]
    CCDS56366.1. [Q8NI17-3]
    CCDS56367.1. [Q8NI17-6]
    RefSeqiNP_001229565.1. NM_001242636.1. [Q8NI17-12]
    NP_001229566.1. NM_001242637.1. [Q8NI17-5]
    NP_001229567.1. NM_001242638.1. [Q8NI17-3]
    NP_001229568.1. NM_001242639.1. [Q8NI17-6]
    NP_620586.3. NM_139017.5. [Q8NI17-2]
    XP_005248485.1. XM_005248428.1. [Q8NI17-4]
    XP_006714591.1. XM_006714528.1. [Q8NI17-8]
    UniGeneiHs.55378.

    Genome annotation databases

    EnsembliENST00000354961; ENSP00000347047; ENSG00000164509. [Q8NI17-3]
    ENST00000359040; ENSP00000351935; ENSG00000164509. [Q8NI17-5]
    ENST00000396834; ENSP00000380046; ENSG00000164509. [Q8NI17-3]
    ENST00000396836; ENSP00000380048; ENSG00000164509. [Q8NI17-8]
    ENST00000447346; ENSP00000415900; ENSG00000164509. [Q8NI17-2]
    ENST00000490985; ENSP00000427533; ENSG00000164509. [Q8NI17-6]
    GeneIDi133396.
    KEGGihsa:133396.
    UCSCiuc003jqk.3. human. [Q8NI17-8]
    uc003jql.3. human. [Q8NI17-2]
    uc003jqm.3. human. [Q8NI17-3]
    uc003jqn.3. human. [Q8NI17-5]
    uc003jqo.3. human. [Q8NI17-1]
    uc021xyq.1. human. [Q8NI17-12]

    Polymorphism databases

    DMDMi74730327.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF486620 mRNA. Translation: AAM27958.1 .
    AY499339 mRNA. Translation: AAS86444.1 . Different initiation.
    AY499340 mRNA. Translation: AAS86445.1 . Different initiation.
    AY499341 mRNA. Translation: AAS86446.1 .
    AY499342 mRNA. Translation: AAS86447.1 .
    AF106913 mRNA. Translation: AAL36452.1 .
    AY358117 mRNA. Translation: AAQ88484.1 .
    AY358740 mRNA. Translation: AAQ89100.1 .
    AC008914 Genomic DNA. No translation available.
    BC110490 mRNA. Translation: AAI10491.1 .
    CCDSi CCDS3970.2. [Q8NI17-2 ]
    CCDS56365.1. [Q8NI17-5 ]
    CCDS56366.1. [Q8NI17-3 ]
    CCDS56367.1. [Q8NI17-6 ]
    RefSeqi NP_001229565.1. NM_001242636.1. [Q8NI17-12 ]
    NP_001229566.1. NM_001242637.1. [Q8NI17-5 ]
    NP_001229567.1. NM_001242638.1. [Q8NI17-3 ]
    NP_001229568.1. NM_001242639.1. [Q8NI17-6 ]
    NP_620586.3. NM_139017.5. [Q8NI17-2 ]
    XP_005248485.1. XM_005248428.1. [Q8NI17-4 ]
    XP_006714591.1. XM_006714528.1. [Q8NI17-8 ]
    UniGenei Hs.55378.

    3D structure databases

    ProteinModelPortali Q8NI17.
    SMRi Q8NI17. Positions 22-227, 237-512.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q8NI17.

    Polymorphism databases

    DMDMi 74730327.

    Proteomic databases

    MaxQBi Q8NI17.
    PaxDbi Q8NI17.
    PRIDEi Q8NI17.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000354961 ; ENSP00000347047 ; ENSG00000164509 . [Q8NI17-3 ]
    ENST00000359040 ; ENSP00000351935 ; ENSG00000164509 . [Q8NI17-5 ]
    ENST00000396834 ; ENSP00000380046 ; ENSG00000164509 . [Q8NI17-3 ]
    ENST00000396836 ; ENSP00000380048 ; ENSG00000164509 . [Q8NI17-8 ]
    ENST00000447346 ; ENSP00000415900 ; ENSG00000164509 . [Q8NI17-2 ]
    ENST00000490985 ; ENSP00000427533 ; ENSG00000164509 . [Q8NI17-6 ]
    GeneIDi 133396.
    KEGGi hsa:133396.
    UCSCi uc003jqk.3. human. [Q8NI17-8 ]
    uc003jql.3. human. [Q8NI17-2 ]
    uc003jqm.3. human. [Q8NI17-3 ]
    uc003jqn.3. human. [Q8NI17-5 ]
    uc003jqo.3. human. [Q8NI17-1 ]
    uc021xyq.1. human. [Q8NI17-12 ]

    Organism-specific databases

    CTDi 133396.
    GeneCardsi GC05P055185.
    HGNCi HGNC:18969. IL31RA.
    MIMi 609510. gene.
    613955. phenotype.
    neXtProti NX_Q8NI17.
    Orphaneti 353220. Familial primary localized cutaneous amyloidosis.
    PharmGKBi PA134952624.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG72763.
    HOVERGENi HBG081788.
    InParanoidi Q8NI17.
    OMAi WGLNESE.
    OrthoDBi EOG7FXZXN.
    PhylomeDBi Q8NI17.
    TreeFami TF338122.

    Enzyme and pathway databases

    SignaLinki Q8NI17.

    Miscellaneous databases

    ChiTaRSi IL31RA. human.
    GeneWikii IL31RA.
    GenomeRNAii 133396.
    NextBioi 83210.
    PROi Q8NI17.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8NI17.
    Bgeei Q8NI17.
    Genevestigatori Q8NI17.

    Family and domain databases

    Gene3Di 2.60.40.10. 3 hits.
    InterProi IPR003961. Fibronectin_type3.
    IPR013783. Ig-like_fold.
    IPR015321. IL-6_rcpt_alpha-bd.
    [Graphical view ]
    Pfami PF00041. fn3. 2 hits.
    PF09240. IL6Ra-bind. 1 hit.
    [Graphical view ]
    SMARTi SM00060. FN3. 4 hits.
    [Graphical view ]
    SUPFAMi SSF49265. SSF49265. 3 hits.
    PROSITEi PS50853. FN3. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A novel type I cytokine receptor is expressed on monocytes, signals proliferation, and activates STAT-3 and STAT-5."
      Ghilardi N., Li J., Hongo J.-A., Yi S., Gurney A., De Sauvage F.J.
      J. Biol. Chem. 277:16831-16836(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, INDUCTION.
    2. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4 AND 5), FUNCTION, OLIGOMERIZATION, TISSUE SPECIFICITY, INDUCTION.
    3. "A novel soluble type 1 cytokine receptor."
      Zhang W., Wan T., He L., Yuan Z., Cao X.
      Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7).
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 8).
    5. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    7. "Signal peptide prediction based on analysis of experimentally verified cleavage sites."
      Zhang Z., Henzel W.J.
      Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: PROTEIN SEQUENCE OF 20-34.
    8. Cited for: ALTERNATIVE SPLICING (ISOFORMS 9; 10; 11 AND 12), FUNCTION, TISSUE SPECIFICITY, INDUCTION, GLYCOSYLATION.
    9. "Predominant expression of the long isoform of GP130-like (GPL) receptor is required for interleukin-31 signaling."
      Diveu C., Lagrue Lak-Hal A.-H., Froger J., Ravon E., Grimaud L., Barbier F., Hermann J., Gascan H., Chevalier S.
      Eur. Cytokine Netw. 15:291-302(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, MUTAGENESIS OF TYR-639; TYR-670 AND TYR-708.
    10. "Characterization of the signaling capacities of the novel gp130-like cytokine receptor."
      Dreuw A., Radtke S., Pflanz S., Lippok B.E., Heinrich P.C., Hermanns H.M.
      J. Biol. Chem. 279:36112-36120(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH JAK1 AND STAT3, MUTAGENESIS OF TYR-639; TYR-670 AND TYR-708.
    11. "IL-31 is associated with cutaneous lymphocyte antigen-positive skin homing T cells in patients with atopic dermatitis."
      Bilsborough J., Leung D.Y.M., Maurer M., Howell M., Boguniewicz M., Yao L., Storey H., LeCiel C., Harder B., Gross J.A.
      J. Allergy Clin. Immunol. 117:418-425(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INDUCTION, TISSUE SPECIFICITY.
    12. Cited for: VARIANT PLCA2 PHE-489.

    Entry informationi

    Entry nameiIL31R_HUMAN
    AccessioniPrimary (citable) accession number: Q8NI17
    Secondary accession number(s): A6NIF8
    , Q2TBA1, Q6EBC3, Q6EBC4, Q6EBC5, Q6EBC6, Q6UWL8, Q8WYJ0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 6, 2007
    Last sequence update: October 1, 2002
    Last modified: October 1, 2014
    This is version 106 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3