Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NI17 (IL31R_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 103. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Interleukin-31 receptor subunit alpha

Short name=IL-31 receptor subunit alpha
Short name=IL-31R subunit alpha
Short name=IL-31R-alpha
Short name=IL-31RA
Alternative name(s):
Cytokine receptor-like 3
GLM-R
Short name=hGLM-R
Gp130-like monocyte receptor
Short name=Gp130-like receptor
ZcytoR17
Gene names
Name:IL31RA
Synonyms:CRL3, GPL
ORF Names:UNQ6368/PRO21073/PRO21384
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length732 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Associates with OSMR to form the interleukin-31 receptor which activates STAT3 and to a lower extent STAT1 and STAT5. May function in skin immunity. Ref.1 Ref.2 Ref.8 Ref.9 Ref.10

Subunit structure

Heterodimer with OSMR. Interacts with JAK1 and STAT3. Ref.2 Ref.10

Subcellular location

Cell membrane; Single-pass type I membrane protein Probable.

Tissue specificity

Expressed at low levels in testis, ovary, brain, prostate, placenta, thymus, bone marrow, trachea and skin. Detected in all of the myelomonocytic lineage. Expressed in CD14- and CD56-positive blood cells and by macrophages (at protein level). Ref.1 Ref.2 Ref.8 Ref.11

Induction

Up-regulated in lesional keratinocytes of patients with atopic dermatitis. Up-regulated by IFNG/IFN-gamma and bacterial lipopolysaccharides (LPS). Ref.1 Ref.2 Ref.8 Ref.11

Post-translational modification

N-glycosylated. Ref.8

Involvement in disease

Amyloidosis, primary localized cutaneous, 2 (PLCA2) [MIM:613955]: A primary amyloidosis characterized by localized cutaneous amyloid deposition. This condition usually presents with itching (especially on the lower legs) and visible changes of skin hyperpigmentation and thickening that may be exacerbated by chronic scratching and rubbing. Primary localized cutaneous amyloidosis is often divided into macular and lichen subtypes although many affected individuals often show both variants coexisting. Lichen amyloidosis characteristically presents as a pruritic eruption of grouped hyperkeratotic papules with a predilection for the shins, calves, ankles and dorsa of feet and thighs. Papules may coalesce to form hyperkeratotic plaques that can resemble lichen planus, lichen simplex or nodular prurigo. Macular amyloidosis is characterized by small pigmented macules that may merge to produce macular hyperpigmentation, sometimes with a reticulate or rippled pattern. In macular and lichen amyloidosis, amyloid is deposited in the papillary dermis in association with grouped colloid bodies, thought to represent degenerate basal keratinocytes. The amyloid deposits probably reflect a combination of degenerate keratin filaments, serum amyloid P component, and deposition of immunoglobulins.
Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.12

Sequence similarities

Belongs to the type I cytokine receptor family. Type 2 subfamily.

Contains 5 fibronectin type-III domains.

Sequence caution

The sequence AAS86444.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAS86445.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Keywords
   Biological processImmunity
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DiseaseAmyloidosis
Disease mutation
   DomainRepeat
Signal
Transmembrane
Transmembrane helix
   Molecular functionReceptor
   PTMGlycoprotein
   Technical termComplete proteome
Direct protein sequencing
Reference proteome
Gene Ontology (GO)
   Biological_processJAK-STAT cascade

Inferred from expression pattern Ref.1. Source: UniProtKB

MAPK cascade

Non-traceable author statement Ref.1. Source: UniProtKB

cytokine-mediated signaling pathway

Traceable author statement Ref.1. Source: UniProtKB

defense response

Non-traceable author statement Ref.1. Source: UniProtKB

homeostatic process

Non-traceable author statement Ref.1. Source: UniProtKB

macrophage differentiation

Non-traceable author statement Ref.1. Source: UniProtKB

monocyte differentiation

Inferred from expression pattern Ref.1. Source: UniProtKB

negative regulation of apoptotic process

Non-traceable author statement Ref.1. Source: UniProtKB

negative regulation of macrophage activation

Non-traceable author statement Ref.1. Source: UniProtKB

positive regulation of cell proliferation

Inferred from direct assay Ref.1. Source: UniProtKB

positive regulation of transcription, DNA-templated

Non-traceable author statement Ref.1. Source: UniProtKB

positive regulation of tyrosine phosphorylation of Stat3 protein

Inferred from expression pattern Ref.1. Source: UniProtKB

positive regulation of tyrosine phosphorylation of Stat5 protein

Inferred from expression pattern Ref.1. Source: UniProtKB

transmembrane receptor protein tyrosine kinase signaling pathway

Non-traceable author statement Ref.1. Source: UniProtKB

   Cellular_componentintegral component of membrane

Non-traceable author statement Ref.1. Source: UniProtKB

plasma membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functioncytokine binding

Non-traceable author statement Ref.1. Source: UniProtKB

cytokine receptor activity

Traceable author statement Ref.1. Source: UniProtKB

protein kinase binding

Non-traceable author statement Ref.1. Source: UniProtKB

transcription coactivator activity

Non-traceable author statement Ref.1. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 12 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8NI17-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8NI17-2)

Also known as: v3;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
Isoform 3 (identifier: Q8NI17-3)

Also known as: v4;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     639-649: YVTCPFRPDCP → TRILSSCPTSI
     650-732: Missing.
Isoform 4 (identifier: Q8NI17-4)

Also known as: v2;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     325-732: Missing.
Isoform 5 (identifier: Q8NI17-5)

Also known as: v1;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     639-649: YVTCPFRPDCP → TRILSSCPTSI
     650-732: Missing.
Isoform 6 (identifier: Q8NI17-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-110: Missing.
Note: No experimental confirmation available.
Isoform 7 (identifier: Q8NI17-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     464-469: GGKGFS → A
     498-501: TSAG → YSGG
     502-732: Missing.
Note: No experimental confirmation available.
Isoform 8 (identifier: Q8NI17-8)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCIRQLKFFTTACVCECPQNILSPQPSCVNLGM
     469-550: SKTVNSSILQ...YGLKKPNKLT → CKHAHSEVEK...RVLRKWKELL
     551-732: Missing.
Note: No experimental confirmation available.
Isoform 9 (identifier: Q8NI17-9)

Also known as: GPL560; short;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     548-732: Missing.
Note: Major isoform. Dominant negative IL31 receptor.
Isoform 10 (identifier: Q8NI17-10)

Also known as: GPL610;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     593-598: LKPCST → RARYQA
     599-732: Missing.
Isoform 11 (identifier: Q8NI17-11)

Also known as: GPL626;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
     593-613: LKPCSTPSDKLVIDKLVVNFG → KGSELGTKLKFKPLISLDCAF
     614-732: Missing.
Isoform 12 (identifier: Q8NI17-12)

Also known as: GPL745; long;

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKLSPQPSCVNLGM
Note: Major isoform. Functional IL31 receptor.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1919 Ref.7
Chain20 – 732713Interleukin-31 receptor subunit alpha
PRO_0000274572

Regions

Topological domain20 – 519500Extracellular Potential
Transmembrane520 – 54021Helical; Potential
Topological domain541 – 732192Cytoplasmic Potential
Domain24 – 12299Fibronectin type-III 1
Domain124 – 225102Fibronectin type-III 2
Domain223 – 31593Fibronectin type-III 3
Domain319 – 41698Fibronectin type-III 4
Domain421 – 51595Fibronectin type-III 5

Amino acid modifications

Glycosylation371N-linked (GlcNAc...) Potential
Glycosylation671N-linked (GlcNAc...) Potential
Glycosylation931N-linked (GlcNAc...) Potential
Glycosylation1661N-linked (GlcNAc...) Potential
Glycosylation1871N-linked (GlcNAc...) Potential
Glycosylation2771N-linked (GlcNAc...) Potential
Glycosylation2831N-linked (GlcNAc...) Potential
Glycosylation3951N-linked (GlcNAc...) Potential
Glycosylation4551N-linked (GlcNAc...) Potential
Glycosylation5041N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 110110Missing in isoform 6.
VSP_022798
Alternative sequence11M → MCIRQLKFFTTACVCECPQN ILSPQPSCVNLGM in isoform 2, isoform 4, isoform 5 and isoform 8.
VSP_022799
Alternative sequence11M → MKLSPQPSCVNLGM in isoform 3, isoform 7, isoform 9, isoform 10, isoform 11 and isoform 12.
VSP_022800
Alternative sequence325 – 732408Missing in isoform 4.
VSP_022801
Alternative sequence464 – 4696GGKGFS → A in isoform 7.
VSP_022802
Alternative sequence469 – 55082SKTVN…PNKLT → CKHAHSEVEKNPKPQIDAMD RPVVGMAPPSHCDLQPGMNH LASLNLSENGAKSTHLLGFW GLNESEVTVPERRVLRKWKE LL in isoform 8.
VSP_022803
Alternative sequence498 – 5014TSAG → YSGG in isoform 7.
VSP_022804
Alternative sequence502 – 732231Missing in isoform 7.
VSP_022805
Alternative sequence548 – 732185Missing in isoform 9.
VSP_022806
Alternative sequence551 – 732182Missing in isoform 8.
VSP_022807
Alternative sequence593 – 61321LKPCS…VVNFG → KGSELGTKLKFKPLISLDCA F in isoform 11.
VSP_022808
Alternative sequence593 – 5986LKPCST → RARYQA in isoform 10.
VSP_022809
Alternative sequence599 – 732134Missing in isoform 10.
VSP_022810
Alternative sequence614 – 732119Missing in isoform 11.
VSP_022811
Alternative sequence639 – 64911YVTCPFRPDCP → TRILSSCPTSI in isoform 3 and isoform 5.
VSP_022812
Alternative sequence650 – 73283Missing in isoform 3 and isoform 5.
VSP_022813
Natural variant1551D → N.
Corresponds to variant rs13184107 [ dbSNP | Ensembl ].
VAR_030328
Natural variant4891S → F in PLCA2. Ref.12
VAR_065809
Natural variant4971S → N.
Corresponds to variant rs161704 [ dbSNP | Ensembl ].
VAR_030329

Experimental info

Mutagenesis6391Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-670 and A-708. Ref.9 Ref.10
Mutagenesis6391Y → F: Abrogates STAT5 activation. Mild effect on STAT1 activation. No effect on STAT3 activation. Ref.9 Ref.10
Mutagenesis6701Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-708. Ref.9 Ref.10
Mutagenesis6701Y → F: No effect on STAT3 and STAT5 activation. Mild effect on STAT1 activation. Ref.9 Ref.10
Mutagenesis7081Y → A: No effect on STAT1 and STAT3 activation. Slight decrease; when associated with A-639 and A-670. Ref.9 Ref.10
Mutagenesis7081Y → F: Abrogates STAT3 activation. Loss of interaction with STAT3. Mild effect on STAT1 activation. No effect on STAT5 activation. Ref.9 Ref.10

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2002. Version 1.
Checksum: 30F84BD3DD99A20E

FASTA73282,954
        10         20         30         40         50         60 
MMWTWALWML PSLCKFSLAA LPAKPENISC VYYYRKNLTC TWSPGKETSY TQYTVKRTYA 

        70         80         90        100        110        120 
FGEKHDNCTT NSSTSENRAS CSFFLPRITI PDNYTIEVEA ENGDGVIKSH MTYWRLENIA 

       130        140        150        160        170        180 
KTEPPKIFRV KPVLGIKRMI QIEWIKPELA PVSSDLKYTL RFRTVNSTSW MEVNFAKNRK 

       190        200        210        220        230        240 
DKNQTYNLTG LQPFTEYVIA LRCAVKESKF WSDWSQEKMG MTEEEAPCGL ELWRVLKPAE 

       250        260        270        280        290        300 
ADGRRPVRLL WKKARGAPVL EKTLGYNIWY YPESNTNLTE TMNTTNQQLE LHLGGESFWV 

       310        320        330        340        350        360 
SMISYNSLGK SPVATLRIPA IQEKSFQCIE VMQACVAEDQ LVVKWQSSAL DVNTWMIEWF 

       370        380        390        400        410        420 
PDVDSEPTTL SWESVSQATN WTIQQDKLKP FWCYNISVYP MLHDKVGEPY SIQAYAKEGV 

       430        440        450        460        470        480 
PSEGPETKVE NIGVKTVTIT WKEIPKSERK GIICNYTIFY QAEGGKGFSK TVNSSILQYG 

       490        500        510        520        530        540 
LESLKRKTSY IVQVMASTSA GGTNGTSINF KTLSFSVFEI ILITSLIGGG LLILIILTVA 

       550        560        570        580        590        600 
YGLKKPNKLT HLCWPTVPNP AESSIATWHG DDFKDKLNLK ESDDSVNTED RILKPCSTPS 

       610        620        630        640        650        660 
DKLVIDKLVV NFGNVLQEIF TDEARTGQEN NLGGEKNGYV TCPFRPDCPL GKSFEELPVS 

       670        680        690        700        710        720 
PEIPPRKSQY LRSRMPEGTR PEAKEQLLFS GQSLVPDHLC EEGAPNPYLK NSVTAREFLV 

       730 
SEKLPEHTKG EV 

« Hide

Isoform 2 (v3) [UniParc].

Checksum: DC1D6BB2EA6AF15F
Show »

FASTA76486,481
Isoform 3 (v4) [UniParc].

Checksum: A49F6363C4B33582
Show »

FASTA66274,876
Isoform 4 (v2) [UniParc].

Checksum: BF4DAD24F5048E1D
Show »

FASTA35641,026
Isoform 5 (v1) [UniParc].

Checksum: C69CC4EF9AC55E42
Show »

FASTA68177,047
Isoform 6 [UniParc].

Checksum: 80E4A3592D040EC6
Show »

FASTA62270,363
Isoform 7 [UniParc].

Checksum: 5DC85C59E170D44B
Show »

FASTA50958,390
Isoform 8 [UniParc].

Checksum: 5EC7B07B84B36057
Show »

FASTA58266,605
Isoform 9 (GPL560) (short) [UniParc].

Checksum: BDE67D9F753AED29
Show »

FASTA56063,638
Isoform 10 (GPL610) [UniParc].

Checksum: EE437BBA84162525
Show »

FASTA61169,491
Isoform 11 (GPL626) [UniParc].

Checksum: FA80DED660647A2F
Show »

FASTA62671,023
Isoform 12 (GPL745) (long) [UniParc].

Checksum: C4A17642CCC0549B
Show »

FASTA74584,309

References

« Hide 'large scale' references
[1]"A novel type I cytokine receptor is expressed on monocytes, signals proliferation, and activates STAT-3 and STAT-5."
Ghilardi N., Li J., Hongo J.-A., Yi S., Gurney A., De Sauvage F.J.
J. Biol. Chem. 277:16831-16836(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, INDUCTION.
[2]"Interleukin 31, a cytokine produced by activated T cells, induces dermatitis in mice."
Dillon S.R., Sprecher C., Hammond A., Bilsborough J., Rosenfeld-Franklin M., Presnell S.R., Haugen H.S., Maurer M., Harder B., Johnston J., Bort S., Mudri S., Kuijper J.L., Bukowski T., Shea P., Dong D.L., Dasovich M., Grant F.J. expand/collapse author list , Lockwood L., Levin S.D., LeCiel C., Waggie K., Day H., Topouzis S., Kramer J., Kuestner R., Chen Z., Foster D., Parrish-Novak J., Gross J.A.
Nat. Immunol. 5:752-760(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4 AND 5), FUNCTION, OLIGOMERIZATION, TISSUE SPECIFICITY, INDUCTION.
[3]"A novel soluble type 1 cytokine receptor."
Zhang W., Wan T., He L., Yuan Z., Cao X.
Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7).
[4]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 8).
[5]"The DNA sequence and comparative analysis of human chromosome 5."
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. expand/collapse author list , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
[7]"Signal peptide prediction based on analysis of experimentally verified cleavage sites."
Zhang Z., Henzel W.J.
Protein Sci. 13:2819-2824(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE OF 20-34.
[8]"GPL, a novel cytokine receptor related to GP130 and leukemia inhibitory factor receptor."
Diveu C., Lelievre E., Perret D., Lagrue Lak-Hal A.-H., Froger J., Guillet C., Chevalier S., Rousseau F., Wesa A., Preisser L., Chabbert M., Gauchat J.-F., Galy A., Gascan H., Morel A.
J. Biol. Chem. 278:49850-49859(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: ALTERNATIVE SPLICING (ISOFORMS 9; 10; 11 AND 12), FUNCTION, TISSUE SPECIFICITY, INDUCTION, GLYCOSYLATION.
[9]"Predominant expression of the long isoform of GP130-like (GPL) receptor is required for interleukin-31 signaling."
Diveu C., Lagrue Lak-Hal A.-H., Froger J., Ravon E., Grimaud L., Barbier F., Hermann J., Gascan H., Chevalier S.
Eur. Cytokine Netw. 15:291-302(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, MUTAGENESIS OF TYR-639; TYR-670 AND TYR-708.
[10]"Characterization of the signaling capacities of the novel gp130-like cytokine receptor."
Dreuw A., Radtke S., Pflanz S., Lippok B.E., Heinrich P.C., Hermanns H.M.
J. Biol. Chem. 279:36112-36120(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH JAK1 AND STAT3, MUTAGENESIS OF TYR-639; TYR-670 AND TYR-708.
[11]"IL-31 is associated with cutaneous lymphocyte antigen-positive skin homing T cells in patients with atopic dermatitis."
Bilsborough J., Leung D.Y.M., Maurer M., Howell M., Boguniewicz M., Yao L., Storey H., LeCiel C., Harder B., Gross J.A.
J. Allergy Clin. Immunol. 117:418-425(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: INDUCTION, TISSUE SPECIFICITY.
[12]"Novel IL31RA gene mutation and ancestral OSMR mutant allele in familial primary cutaneous amyloidosis."
Lin M.W., Lee D.D., Liu T.T., Lin Y.F., Chen S.Y., Huang C.C., Weng H.Y., Liu Y.F., Tanaka A., Arita K., Lai-Cheong J., Palisson F., Chang Y.T., Wong C.K., Matsuura I., McGrath J.A., Tsai S.F.
Eur. J. Hum. Genet. 18:26-32(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT PLCA2 PHE-489.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF486620 mRNA. Translation: AAM27958.1.
AY499339 mRNA. Translation: AAS86444.1. Different initiation.
AY499340 mRNA. Translation: AAS86445.1. Different initiation.
AY499341 mRNA. Translation: AAS86446.1.
AY499342 mRNA. Translation: AAS86447.1.
AF106913 mRNA. Translation: AAL36452.1.
AY358117 mRNA. Translation: AAQ88484.1.
AY358740 mRNA. Translation: AAQ89100.1.
AC008914 Genomic DNA. No translation available.
BC110490 mRNA. Translation: AAI10491.1.
RefSeqNP_001229565.1. NM_001242636.1.
NP_001229566.1. NM_001242637.1.
NP_001229567.1. NM_001242638.1.
NP_001229568.1. NM_001242639.1.
NP_620586.3. NM_139017.5.
XP_005248485.1. XM_005248428.1.
UniGeneHs.55378.

3D structure databases

ProteinModelPortalQ8NI17.
SMRQ8NI17. Positions 22-227, 237-512.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ8NI17.

Polymorphism databases

DMDM74730327.

Proteomic databases

PaxDbQ8NI17.
PRIDEQ8NI17.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000354961; ENSP00000347047; ENSG00000164509. [Q8NI17-3]
ENST00000359040; ENSP00000351935; ENSG00000164509. [Q8NI17-5]
ENST00000396834; ENSP00000380046; ENSG00000164509. [Q8NI17-3]
ENST00000396836; ENSP00000380048; ENSG00000164509. [Q8NI17-8]
ENST00000447346; ENSP00000415900; ENSG00000164509. [Q8NI17-2]
ENST00000490985; ENSP00000427533; ENSG00000164509. [Q8NI17-6]
GeneID133396.
KEGGhsa:133396.
UCSCuc003jqk.3. human. [Q8NI17-8]
uc003jql.3. human. [Q8NI17-2]
uc003jqm.3. human. [Q8NI17-3]
uc003jqn.3. human. [Q8NI17-5]
uc003jqo.3. human. [Q8NI17-1]
uc021xyq.1. human. [Q8NI17-12]

Organism-specific databases

CTD133396.
GeneCardsGC05P055185.
HGNCHGNC:18969. IL31RA.
MIM609510. gene.
613955. phenotype.
neXtProtNX_Q8NI17.
Orphanet353220. Familial primary localized cutaneous amyloidosis.
PharmGKBPA134952624.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG72763.
HOVERGENHBG081788.
InParanoidQ8NI17.
OMADTWMVEW.
OrthoDBEOG7FXZXN.
PhylomeDBQ8NI17.
TreeFamTF338122.

Enzyme and pathway databases

SignaLinkQ8NI17.

Gene expression databases

ArrayExpressQ8NI17.
BgeeQ8NI17.
GenevestigatorQ8NI17.

Family and domain databases

Gene3D2.60.40.10. 3 hits.
InterProIPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR015321. IL-6_rcpt_alpha-bd.
[Graphical view]
PfamPF00041. fn3. 2 hits.
PF09240. IL6Ra-bind. 1 hit.
[Graphical view]
SMARTSM00060. FN3. 4 hits.
[Graphical view]
SUPFAMSSF49265. SSF49265. 3 hits.
PROSITEPS50853. FN3. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSIL31RA. human.
GeneWikiIL31RA.
GenomeRNAi133396.
NextBio83210.
PROQ8NI17.
SOURCESearch...

Entry information

Entry nameIL31R_HUMAN
AccessionPrimary (citable) accession number: Q8NI17
Secondary accession number(s): A6NIF8 expand/collapse secondary AC list , Q2TBA1, Q6EBC3, Q6EBC4, Q6EBC5, Q6EBC6, Q6UWL8, Q8WYJ0
Entry history
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: October 1, 2002
Last modified: April 16, 2014
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM