Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase RFWD2

Gene

RFWD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Involved in JUN ubiquitination and degradation. Directly involved in p53 (TP53) ubiquitination and degradation, thereby abolishing p53-dependent transcription and apoptosis. Ubiquitinates p53 independently of MDM2 or RCHY1. Probably mediates E3 ubiquitin ligase activity by functioning as the essential RING domain subunit of larger E3 complexes. In contrast, it does not constitute the catalytic RING subunit in the DCX DET1-COP1 complex that negatively regulates JUN, the ubiquitin ligase activity being mediated by RBX1. Involved in 14-3-3 protein sigma/SFN ubiquitination and proteasomal degradation, leading to AKT activation and promotion of cell survival. Ubiquitinates MTA1 leading to its proteasomal degradation.7 Publications

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri136 – 17439RING-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  • ligase activity Source: UniProtKB-KW
  • ubiquitin protein ligase activity Source: UniProtKB
  • ubiquitin-protein transferase activity Source: Reactome
  • zinc ion binding Source: InterPro

GO - Biological processi

  • positive regulation of proteasomal ubiquitin-dependent protein catabolic process Source: UniProtKB
  • response to ionizing radiation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-349425. Autodegradation of the E3 ubiquitin ligase COP1.
SignaLinkiQ8NHY2.
SIGNORiQ8NHY2.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase RFWD2 (EC:6.3.2.-)
Alternative name(s):
Constitutive photomorphogenesis protein 1 homolog
Short name:
hCOP1
RING finger and WD repeat domain protein 2
RING finger protein 200
Gene namesi
Name:RFWD2
Synonyms:COP1, RNF200
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:17440. RFWD2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi111 – 1133RKR → AKA: Abolishes localization to the nucleus. 1 Publication
Mutagenesisi136 – 1361C → A: Abolishes p53 ubiquitination and degradation but not that of JUN; when associated with A-139. 4 Publications
Mutagenesisi136 – 1361C → S: Loss of SFN and MTA1 ubiquitination and degradation; when associated with S-139. Loss of stabilization by COPS6; when associated with S-139. 4 Publications
Mutagenesisi139 – 1391C → A: Abolishes p53 ubiquitination and degradation but not that of JUN; when associated with A-136. 4 Publications
Mutagenesisi139 – 1391C → S: Loss of SFN and MTA1 ubiquitination and degradation; when associated with S-136. Loss of stabilization by COPS6; when associated with S-136. 4 Publications
Mutagenesisi156 – 1561C → S: Loss of MTA1 ubiquitination and degradation; when associated with S-159. 1 Publication
Mutagenesisi159 – 1591C → S: Loss of MTA1 ubiquitination and degradation; when associated with S-156. 1 Publication

Organism-specific databases

PharmGKBiPA134952161.

Polymorphism and mutation databases

DMDMi55976539.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 731731E3 ubiquitin-protein ligase RFWD2PRO_0000055879Add
BLAST

Post-translational modificationi

Autoubiquitinated. MTA1 destabilizes it by promoting its autoubiquitination.1 Publication

Keywords - PTMi

Ubl conjugation

Proteomic databases

EPDiQ8NHY2.
MaxQBiQ8NHY2.
PaxDbiQ8NHY2.
PeptideAtlasiQ8NHY2.
PRIDEiQ8NHY2.

PTM databases

iPTMnetiQ8NHY2.
PhosphoSiteiQ8NHY2.

Expressioni

Tissue specificityi

Ubiquitously expressed at low level. Expressed at higher level in testis, placenta, skeletal muscle and heart.2 Publications

Inductioni

By p53/TP53.1 Publication

Gene expression databases

BgeeiENSG00000143207.
CleanExiHS_RFWD2.
ExpressionAtlasiQ8NHY2. baseline and differential.
GenevisibleiQ8NHY2. HS.

Organism-specific databases

HPAiHPA028197.

Interactioni

Subunit structurei

Homodimer. Homodimerization is mediated by the coiled coil domain. Component of the DCX DET1-COP1 ubiquitin ligase complex at least composed of RBX1, DET1, DDB1, CUL4A and COP1. Isoform 2 does not interact with CUL4A but still binds to RBX1, suggesting that the interaction may be mediated by another cullin protein. Isoform 1 and isoform 2 interact with CUL5 but not with CUL1, CUL2 not CUL3. Interacts with bZIP transcription factors JUN, JUNB and JUND but not with FOS, ATF2 nor XBP1. Interacts with p53 (TP53). Interacts with COPS6; this interaction stabilizes RFWD2 through reducing its auto-ubiquitination and decelerating its turnover rate. Interacts with SFN; this interaction leads to SFN degradation. Isoform 4 forms heterodimers with isoform 1, preventing its association with DET1. Interacts with p53/TP53 and MTA1.6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
COPS6Q7L5N13EBI-1176214,EBI-486838
ETS1P14921-13EBI-1176214,EBI-913224
ETS2P150362EBI-1176214,EBI-1646991
SFNP319476EBI-1176214,EBI-476295

Protein-protein interaction databases

BioGridi122136. 92 interactions.
DIPiDIP-36661N.
IntActiQ8NHY2. 25 interactions.
MINTiMINT-260162.
STRINGi9606.ENSP00000356641.

Structurei

Secondary structure

1
731
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi392 – 3998Combined sources
Beta strandi404 – 4129Combined sources
Beta strandi424 – 4296Combined sources
Beta strandi433 – 4408Combined sources
Beta strandi443 – 4497Combined sources
Helixi450 – 4534Combined sources
Beta strandi464 – 4685Combined sources
Beta strandi473 – 4786Combined sources
Beta strandi485 – 4906Combined sources
Beta strandi495 – 4995Combined sources
Turni500 – 5023Combined sources
Beta strandi505 – 5095Combined sources
Beta strandi516 – 5216Combined sources
Beta strandi528 – 5336Combined sources
Beta strandi536 – 5427Combined sources
Beta strandi549 – 5535Combined sources
Beta strandi558 – 5636Combined sources
Beta strandi570 – 5756Combined sources
Beta strandi580 – 5845Combined sources
Beta strandi592 – 5954Combined sources
Beta strandi602 – 61716Combined sources
Turni618 – 6203Combined sources
Beta strandi621 – 6266Combined sources
Beta strandi633 – 6364Combined sources
Beta strandi642 – 6443Combined sources
Beta strandi648 – 6514Combined sources
Beta strandi654 – 6585Combined sources
Beta strandi662 – 6687Combined sources
Beta strandi676 – 6794Combined sources
Beta strandi700 – 7056Combined sources
Beta strandi709 – 7113Combined sources
Beta strandi715 – 7206Combined sources
Beta strandi723 – 7319Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
5HQGX-ray2.00A376-731[»]
5IGQX-ray3.90A/B/C/D/E/F386-731[»]
ProteinModelPortaliQ8NHY2.
SMRiQ8NHY2. Positions 134-193, 424-730.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati419 – 45840WD 1Add
BLAST
Repeati468 – 50841WD 2Add
BLAST
Repeati511 – 55141WD 3Add
BLAST
Repeati553 – 59341WD 4Add
BLAST
Repeati597 – 63539WD 5Add
BLAST
Repeati638 – 67740WD 6Add
BLAST
Repeati691 – 72939WD 7Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili233 – 30169Sequence analysisAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi109 – 1135Nuclear localization signal 1
Motifi195 – 20612Nuclear localization signal 2Add
BLAST
Motifi235 – 24511Nuclear export signalBy similarityAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi2 – 110109Ser-richAdd
BLAST

Domaini

The RING finger domain, in addition to its role in ubiquitination, functions as a structural scaffold to bring two clusters of positive-charged residues within spatial proximity to mimic a bipartite nuclear localization signal (NLS).By similarity

Sequence similaritiesi

Belongs to the COP1 family.Curated
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation
Contains 7 WD repeats.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri136 – 17439RING-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Coiled coil, Repeat, WD repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IE71. Eukaryota.
ENOG410XNTU. LUCA.
GeneTreeiENSGT00570000079069.
HOGENOMiHOG000006123.
HOVERGENiHBG054995.
InParanoidiQ8NHY2.
KOiK10143.
OMAiFSTRMTR.
OrthoDBiEOG091G0ERB.
PhylomeDBiQ8NHY2.
TreeFamiTF328912.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR033313. RFWD2/COP1.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PANTHERiPTHR22847:SF451. PTHR22847:SF451. 2 hits.
PfamiPF00400. WD40. 5 hits.
[Graphical view]
SMARTiSM00184. RING. 1 hit.
SM00320. WD40. 6 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NHY2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGSRQAGSG SAGTSPGSSA ASSVTSASSS LSSSPSPPSV AVSAAALVSG
60 70 80 90 100
GVAQAAGSGG LGGPVRPVLV APAVSGSGGG AVSTGLSRHS CAARPSAGVG
110 120 130 140 150
GSSSSLGSGS RKRPLLAPLC NGLINSYEDK SNDFVCPICF DMIEEAYMTK
160 170 180 190 200
CGHSFCYKCI HQSLEDNNRC PKCNYVVDNI DHLYPNFLVN ELILKQKQRF
210 220 230 240 250
EEKRFKLDHS VSSTNGHRWQ IFQDWLGTDQ DNLDLANVNL MLELLVQKKK
260 270 280 290 300
QLEAESHAAQ LQILMEFLKV ARRNKREQLE QIQKELSVLE EDIKRVEEMS
310 320 330 340 350
GLYSPVSEDS TVPQFEAPSP SHSSIIDSTE YSQPPGFSGS SQTKKQPWYN
360 370 380 390 400
STLASRRKRL TAHFEDLEQC YFSTRMSRIS DDSRTASQLD EFQECLSKFT
410 420 430 440 450
RYNSVRPLAT LSYASDLYNG SSIVSSIEFD RDCDYFAIAG VTKKIKVYEY
460 470 480 490 500
DTVIQDAVDI HYPENEMTCN SKISCISWSS YHKNLLASSD YEGTVILWDG
510 520 530 540 550
FTGQRSKVYQ EHEKRCWSVD FNLMDPKLLA SGSDDAKVKL WSTNLDNSVA
560 570 580 590 600
SIEAKANVCC VKFSPSSRYH LAFGCADHCV HYYDLRNTKQ PIMVFKGHRK
610 620 630 640 650
AVSYAKFVSG EEIVSASTDS QLKLWNVGKP YCLRSFKGHI NEKNFVGLAS
660 670 680 690 700
NGDYIACGSE NNSLYLYYKG LSKTLLTFKF DTVKSVLDKD RKEDDTNEFV
710 720 730
SAVCWRALPD GESNVLIAAN SQGTIKVLEL V
Length:731
Mass (Da):80,474
Last modified:October 1, 2002 - v1
Checksum:iC4B262268D01FA00
GO
Isoform 2 (identifier: Q8NHY2-2) [UniParc]FASTAAdd to basket
Also known as: delta24

The sequence of this isoform differs from the canonical sequence as follows:
     211-214: Missing.
     277-296: Missing.

Show »
Length:707
Mass (Da):77,691
Checksum:iF2FC1F37C42BDAE2
GO
Isoform 3 (identifier: Q8NHY2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-264: Missing.
     342-342: Q → QAGVQWRYLGSLQPPPPRYKRFSCLTLPSSWDYRRLPPHL

Note: No experimental confirmation available.
Show »
Length:506
Mass (Da):57,527
Checksum:i7B428234153E7490
GO
Isoform 4 (identifier: Q8NHY2-4) [UniParc]FASTAAdd to basket
Also known as: COP1D

The sequence of this isoform differs from the canonical sequence as follows:
     277-296: Missing.

Note: Unable to associate with other components of the CRL complex. Acts as a dominant-negative.
Show »
Length:711
Mass (Da):78,066
Checksum:i6E3E5405CD510EB8
GO
Isoform 5 (identifier: Q8NHY2-5) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     157-157: Y → E
     158-731: Missing.

Show »
Length:157
Mass (Da):14,914
Checksum:i544697228ACBECC6
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 264264Missing in isoform 3. 1 PublicationVSP_012026Add
BLAST
Alternative sequencei157 – 1571Y → E in isoform 5. 1 PublicationVSP_055894
Alternative sequencei158 – 731574Missing in isoform 5. 1 PublicationVSP_055895Add
BLAST
Alternative sequencei211 – 2144Missing in isoform 2. 1 PublicationVSP_012024
Alternative sequencei277 – 29620Missing in isoform 2 and isoform 4. 1 PublicationVSP_012025Add
BLAST
Alternative sequencei342 – 3421Q → QAGVQWRYLGSLQPPPPRYK RFSCLTLPSSWDYRRLPPHL in isoform 3. 1 PublicationVSP_012027

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF508940 mRNA. Translation: AAM34692.1.
BK000438 Genomic DNA. Translation: DAA01050.1.
AF527539 mRNA. Translation: AAQ08989.1.
AY509921 mRNA. Translation: AAS82851.1.
KJ534928 mRNA. Translation: AHW56568.1.
KJ535076 mRNA. Translation: AHW56715.1.
AK025789 mRNA. Translation: BAB15239.1.
AK314750 mRNA. Translation: BAG37289.1.
AL359265
, AL162736, AL513329, AL590723 Genomic DNA. Translation: CAH71140.1.
AL513329
, AL162736, AL359265, AL590723 Genomic DNA. Translation: CAH72425.1.
AL162736
, AL359265, AL513329, AL590723 Genomic DNA. Translation: CAH73625.1.
AL590723
, AL162736, AL359265, AL513329 Genomic DNA. Translation: CAI14643.1.
CH471067 Genomic DNA. Translation: EAW91000.1.
BC094728 mRNA. Translation: AAH94728.1.
CCDSiCCDS30944.1. [Q8NHY2-1]
CCDS44279.1. [Q8NHY2-2]
RefSeqiNP_001001740.1. NM_001001740.3. [Q8NHY2-2]
NP_001273573.1. NM_001286644.1.
NP_071902.2. NM_022457.6. [Q8NHY2-1]
UniGeneiHs.523744.

Genome annotation databases

EnsembliENST00000308769; ENSP00000310943; ENSG00000143207. [Q8NHY2-2]
ENST00000367669; ENSP00000356641; ENSG00000143207. [Q8NHY2-1]
ENST00000474194; ENSP00000433517; ENSG00000143207. [Q8NHY2-5]
GeneIDi64326.
KEGGihsa:64326.
UCSCiuc001gku.3. human. [Q8NHY2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF508940 mRNA. Translation: AAM34692.1.
BK000438 Genomic DNA. Translation: DAA01050.1.
AF527539 mRNA. Translation: AAQ08989.1.
AY509921 mRNA. Translation: AAS82851.1.
KJ534928 mRNA. Translation: AHW56568.1.
KJ535076 mRNA. Translation: AHW56715.1.
AK025789 mRNA. Translation: BAB15239.1.
AK314750 mRNA. Translation: BAG37289.1.
AL359265
, AL162736, AL513329, AL590723 Genomic DNA. Translation: CAH71140.1.
AL513329
, AL162736, AL359265, AL590723 Genomic DNA. Translation: CAH72425.1.
AL162736
, AL359265, AL513329, AL590723 Genomic DNA. Translation: CAH73625.1.
AL590723
, AL162736, AL359265, AL513329 Genomic DNA. Translation: CAI14643.1.
CH471067 Genomic DNA. Translation: EAW91000.1.
BC094728 mRNA. Translation: AAH94728.1.
CCDSiCCDS30944.1. [Q8NHY2-1]
CCDS44279.1. [Q8NHY2-2]
RefSeqiNP_001001740.1. NM_001001740.3. [Q8NHY2-2]
NP_001273573.1. NM_001286644.1.
NP_071902.2. NM_022457.6. [Q8NHY2-1]
UniGeneiHs.523744.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
5HQGX-ray2.00A376-731[»]
5IGQX-ray3.90A/B/C/D/E/F386-731[»]
ProteinModelPortaliQ8NHY2.
SMRiQ8NHY2. Positions 134-193, 424-730.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122136. 92 interactions.
DIPiDIP-36661N.
IntActiQ8NHY2. 25 interactions.
MINTiMINT-260162.
STRINGi9606.ENSP00000356641.

PTM databases

iPTMnetiQ8NHY2.
PhosphoSiteiQ8NHY2.

Polymorphism and mutation databases

DMDMi55976539.

Proteomic databases

EPDiQ8NHY2.
MaxQBiQ8NHY2.
PaxDbiQ8NHY2.
PeptideAtlasiQ8NHY2.
PRIDEiQ8NHY2.

Protocols and materials databases

DNASUi64326.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000308769; ENSP00000310943; ENSG00000143207. [Q8NHY2-2]
ENST00000367669; ENSP00000356641; ENSG00000143207. [Q8NHY2-1]
ENST00000474194; ENSP00000433517; ENSG00000143207. [Q8NHY2-5]
GeneIDi64326.
KEGGihsa:64326.
UCSCiuc001gku.3. human. [Q8NHY2-1]

Organism-specific databases

CTDi64326.
GeneCardsiRFWD2.
HGNCiHGNC:17440. RFWD2.
HPAiHPA028197.
MIMi608067. gene.
neXtProtiNX_Q8NHY2.
PharmGKBiPA134952161.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IE71. Eukaryota.
ENOG410XNTU. LUCA.
GeneTreeiENSGT00570000079069.
HOGENOMiHOG000006123.
HOVERGENiHBG054995.
InParanoidiQ8NHY2.
KOiK10143.
OMAiFSTRMTR.
OrthoDBiEOG091G0ERB.
PhylomeDBiQ8NHY2.
TreeFamiTF328912.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiR-HSA-349425. Autodegradation of the E3 ubiquitin ligase COP1.
SignaLinkiQ8NHY2.
SIGNORiQ8NHY2.

Miscellaneous databases

ChiTaRSiRFWD2. human.
GeneWikiiRFWD2.
GenomeRNAii64326.
PROiQ8NHY2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000143207.
CleanExiHS_RFWD2.
ExpressionAtlasiQ8NHY2. baseline and differential.
GenevisibleiQ8NHY2. HS.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR033313. RFWD2/COP1.
IPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR019775. WD40_repeat_CS.
IPR017986. WD40_repeat_dom.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PANTHERiPTHR22847:SF451. PTHR22847:SF451. 2 hits.
PfamiPF00400. WD40. 5 hits.
[Graphical view]
SMARTiSM00184. RING. 1 hit.
SM00320. WD40. 6 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS00678. WD_REPEATS_1. 1 hit.
PS50082. WD_REPEATS_2. 2 hits.
PS50294. WD_REPEATS_REGION. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRFWD2_HUMAN
AccessioniPrimary (citable) accession number: Q8NHY2
Secondary accession number(s): E9PKI0
, Q504W6, Q6H103, Q9H6L7, X5D9B4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: October 1, 2002
Last modified: September 7, 2016
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.