Q8NHY0 (B4GN2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Beta-1,4 N-acetylgalactosaminyltransferase 2 EC=2.4.1.- Alternative name(s): Sd(a) beta-1,4-GalNAc transferase UDP-GalNAc:Neu5Aca2-3Galb-R b1,4-N-acetylgalactosaminyltransferase | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 566 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Involved in the synthesis of the Sd(a) antigen (Sia-alpha2,3-[GalNAc-beta1,4]Gal-beta1,4-GlcNAc), a carbohydrate determinant expressed on erythrocytes, the colonic mucosa and other tissues. Transfers a beta-1,4-linked GalNAc to the galactose residue of an alpha-2,3-sialylated chain. Ref.1 Ref.2 |
| Pathway | |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein Potential. |
| Tissue specificity | Widely expressed. Highly expressed in colon and to a lesser extent in kidney, stomach, ileum and rectum. Ref.1 |
| Sequence similarities | Belongs to the glycosyltransferase 2 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Molecular function | Glycosyltransferase Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | UDP-N-acetylgalactosamine metabolic process Inferred from direct assay Ref.1Ref.2. Source: UniProtKB lipid glycosylationInferred from electronic annotation. Source: InterPro negative regulation of cell-cell adhesionInferred from direct assay. Source: UniProtKB |
| Cellular component | integral to Golgi membrane Inferred from electronic annotation. Source: InterPro |
| Molecular function | acetylgalactosaminyltransferase activity Inferred from direct assay Ref.1Ref.2. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NHY0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NHY0-2) The sequence of this isoform differs from the canonical sequence as follows: 1-64: MGSAGFSVGKFHVEVASRGRECVSGTPECGNRLGSAGFGALCLELRGADPAWGPFAAHGRSRRQ → MTSG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 566 | 566 | Beta-1,4 N-acetylgalactosaminyltransferase 2 | PRO_0000059103 | |||||
Regions | |||||||||
| Topological domain | 1 – 67 | 67 | Cytoplasmic Potential | ||||||
| Transmembrane | 68 – 88 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 89 – 566 | 478 | Lumenal Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 64 | 64 | MGSAG…RSRRQ → MTSG in isoform 2. | VSP_017131 | |||||
| Natural variant | 40 | 1 | A → D. Ref.1 Ref.2 Ref.4 Corresponds to variant rs7207403 [ dbSNP | Ensembl ]. | VAR_049238 | |||||
| Natural variant | 459 | 1 | P → H in a colorectal cancer sample; somatic mutation. Ref.5 | VAR_035990 | |||||
| Natural variant | 466 | 1 | C → R. Corresponds to variant rs7224888 [ dbSNP | Ensembl ]. | VAR_049239 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning, gene organization and expression of the human UDP-GalNAc:Neu5Acalpha2-3Galbeta-R beta1,4-N-acetylgalactosaminyltransferase responsible for the biosynthesis of the blood group Sda/Cad antigen: evidence for an unusual extended cytoplasmic domain." Montiel M.D., Krzewinski-Recchi M.A., Delannoy P., Harduin-Lepers A. Biochem. J. 373:369-379(2003) [PubMed: 12678917] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, TISSUE SPECIFICITY, VARIANT ASP-40. |
| [2] | "Molecular cloning of the human beta1,4 N-acetylgalactosaminyltransferase responsible for the biosynthesis of the Sd(a) histo-blood group antigen: the sequence predicts a very long cytoplasmic domain." Lo Presti L., Cabuy E., Chiricolo M., Dall'Olio F. J. Biochem. 134:675-682(2003) [PubMed: 14688233] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, VARIANT ASP-40. |
| [3] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed: 16625196] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASP-40. |
| [5] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed: 16959974] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] HIS-459. |
| + | Additional computationally mapped references. |
Web resources
| GGDB GlycoGene database |
| Functional Glycomics Gateway - GTase Beta-1,4 N-acetylgalactosaminyltransferase 2 |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ517770 mRNA. Translation: CAD57148.1. AJ517771 mRNA. Translation: CAD57149.1. AF510036 mRNA. Translation: AAM34756.1. AC069454 Genomic DNA. No translation available. BC113675 mRNA. Translation: AAI13676.1. BC113677 mRNA. Translation: AAI13678.1. |
| IPI | IPI00169373. IPI00718973. |
| RefSeq | NP_001152859.1. NM_001159387.1. NP_001152860.1. NM_001159388.1. NP_703147.2. NM_153446.2. |
| UniGene | Hs.374679. |
3D structure databases | |
| ProteinModelPortal | Q8NHY0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q8NHY0. |
Protein family/group databases | |
| CAZy | GT12. Glycosyltransferase Family 12. |
PTM databases | |
| PhosphoSite | Q8NHY0. |
Polymorphism databases | |
| DMDM | 296434406. |
Proteomic databases | |
| PRIDE | Q8NHY0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000300404; ENSP00000300404; ENSG00000167080. |
| GeneID | 124872. |
| KEGG | hsa:124872. |
| UCSC | uc002ion.1. human. |
Organism-specific databases | |
| CTD | 124872. |
| GeneCards | GC17P047210. |
| HGNC | HGNC:24136. B4GALNT2. |
| HPA | HPA015721. |
| neXtProt | NX_Q8NHY0. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG11505. |
| GeneTree | ENSGT00390000006679. |
| HOGENOM | HBG445842. |
| HOVERGEN | HBG004812. |
| InParanoid | Q8NHY0. |
| OMA | FEHFQRR. |
| OrthoDB | EOG4SQWWF. |
| PhylomeDB | Q8NHY0. |
Enzyme and pathway databases | |
| BRENDA | 2.4.1.165. 2681. |
Gene expression databases | |
| ArrayExpress | Q8NHY0. |
| Bgee | Q8NHY0. |
| CleanEx | HS_B4GALNT2. |
| Genevestigator | Q8NHY0. |
| GermOnline | ENSG00000167080. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001173. Glyco_trans_2. IPR011143. GM2_synthase. [Graphical view] |
| KO | K09655. |
| Pfam | PF00535. Glycos_transf_2. 1 hit. [Graphical view] |
| PIRSF | PIRSF000474. GM2_GD2_synthase. 1 hit. |
| ProtoNet | Search... |
Other | |
| NextBio | 81412. |
Entry information
| Entry name | B4GN2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NHY0 Secondary accession number(s): Q14CP1, Q86Y40 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with