Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NHW4

- CC4L_HUMAN

UniProt

Q8NHW4 - CC4L_HUMAN

Protein

C-C motif chemokine 4-like

Gene

CCL4L1

more
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Chemokine that induces chemotaxis of cells expressing CCR5 or CCR1. Inhibits HIV replication in peripheral blood monocytes that express CCR5.1 Publication

    GO - Biological processi

    1. cell chemotaxis Source: GOC
    2. immune response Source: InterPro
    3. inflammatory response Source: UniProtKB-KW

    Keywords - Molecular functioni

    Cytokine

    Keywords - Biological processi

    Chemotaxis, Inflammatory response

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    C-C motif chemokine 4-like
    Alternative name(s):
    Lymphocyte activation gene 1 protein
    Short name:
    LAG-1
    Macrophage inflammatory protein 1-beta
    Short name:
    MIP-1-beta
    Monocyte adherence-induced protein 5-alpha
    Small-inducible cytokine A4-like
    Gene namesi
    Name:CCL4L1
    Synonyms:CCL4L, LAG1, SCYA4L1
    AND
    Name:CCL4L2
    Synonyms:CCL4L, SCYA4L2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:10631. CCL4L1.
    HGNC:24066. CCL4L2.

    Subcellular locationi

    Secreted By similarity

    GO - Cellular componenti

    1. extracellular space Source: UniProtKB-KW

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA35563.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2323By similarityAdd
    BLAST
    Chaini24 – 9269C-C motif chemokine 4-likePRO_0000326234Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi34 ↔ 58By similarity
    Disulfide bondi35 ↔ 74By similarity

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PaxDbiQ8NHW4.
    PRIDEiQ8NHW4.

    Expressioni

    Tissue specificityi

    Detected in B-cells.1 Publication

    Gene expression databases

    BgeeiQ8NHW4.
    CleanExiHS_CCL4L1.
    GenevestigatoriQ8NHW4.

    Interactioni

    Subunit structurei

    Interacts with CCR5.1 Publication

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NHW4.
    SMRiQ8NHW4. Positions 27-92.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG124416.
    HOVERGENiHBG017871.
    KOiK12964.
    OMAiPAFSAPI.
    PhylomeDBiQ8NHW4.
    TreeFamiTF334888.

    Family and domain databases

    InterProiIPR000827. Chemokine_CC_CS.
    IPR001811. Chemokine_IL8-like_dom.
    [Graphical view]
    PfamiPF00048. IL8. 1 hit.
    [Graphical view]
    SMARTiSM00199. SCY. 1 hit.
    [Graphical view]
    SUPFAMiSSF54117. SSF54117. 1 hit.
    PROSITEiPS00472. SMALL_CYTOKINES_CC. 1 hit.
    [Graphical view]

    Sequences (10)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 10 isoformsi produced by alternative splicing. Align

    Note: CCL4L1 and CCL4L2 genes differ in their non-coding regions. Thus, alternative splicing events differ between the two genes.

    Isoform 1 (identifier: Q8NHW4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKLCVTVLSL LVLVAAFCSL ALSAPMGSDP PTACCFSYTA RKLPRNFVVD   50
    YYETSSLCSQ PAVVFQTKRG KQVCADPSES WVQEYVYDLE LN 92
    Length:92
    Mass (Da):10,166
    Last modified:October 1, 2002 - v1
    Checksum:i4C8D01E926CDE882
    GO
    Isoform 2 (identifier: Q8NHW4-2) [UniParc]FASTAAdd to Basket

    Also known as: CCL4L2

    The sequence of this isoform differs from the canonical sequence as follows:
         65-69: Missing.

    Show »
    Length:87
    Mass (Da):9,505
    Checksum:i8140E8AA4D95C05C
    GO
    Isoform 3 (identifier: Q8NHW4-3) [UniParc]FASTAAdd to Basket

    Also known as: CC4L2d

    The sequence of this isoform differs from the canonical sequence as follows:
         65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR

    Show »
    Length:96
    Mass (Da):10,227
    Checksum:iCA14E1C6FC2D1745
    GO
    Isoform 4 (identifier: Q8NHW4-4) [UniParc]FASTAAdd to Basket

    Also known as: CC4L2f

    The sequence of this isoform differs from the canonical sequence as follows:
         65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → EWKLQGVCFQCCSGKDPIHQSCPTWTMVRQRKMPTTGKG

    Show »
    Length:103
    Mass (Da):11,286
    Checksum:i5603FE25DE1B08E9
    GO
    Isoform 5 (identifier: Q8NHW4-5) [UniParc]FASTAAdd to Basket

    Also known as: CC4L2b1, CC4L2b2

    The sequence of this isoform differs from the canonical sequence as follows:
         65-92: Missing.

    Show »
    Length:64
    Mass (Da):6,850
    Checksum:i60EA92F22897BEDF
    GO
    Isoform 6 (identifier: Q8NHW4-6) [UniParc]FASTAAdd to Basket

    Also known as: CC4L2e

    The sequence of this isoform differs from the canonical sequence as follows:
         65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPHGPWSGRGRCLPQARDKAR

    Show »
    Length:86
    Mass (Da):9,220
    Checksum:iBE0C616BBA0CBDC8
    GO
    Isoform 7 (identifier: Q8NHW4-7) [UniParc]FASTAAdd to Basket

    Also known as: CC4L2d2

    The sequence of this isoform differs from the canonical sequence as follows:
         26-92: MGSDPPTACC...QEYVYDLELN → KASKSALTPVSPGSRSTCMTWN

    Show »
    Length:47
    Mass (Da):4,855
    Checksum:iE0D5FB87C91506C9
    GO
    Isoform 8 (identifier: Q8NHW4-8) [UniParc]FASTAAdd to Basket

    Also known as: CC4L1d2

    The sequence of this isoform differs from the canonical sequence as follows:
         26-92: MGSDPPTACC...QEYVYDLELN → NSKPKEASKSALTPVSPGSRSTCMTWN

    Show »
    Length:52
    Mass (Da):5,410
    Checksum:iC066A711CE38A507
    GO
    Isoform 9 (identifier: Q8NHW4-9) [UniParc]FASTAAdd to Basket

    Also known as: CC4L2bd2

    The sequence of this isoform differs from the canonical sequence as follows:
         26-92: MGSDPPTACC...QEYVYDLELN → TKSSEWKLQG...QRKMPTTGKG

    Show »
    Length:68
    Mass (Da):7,403
    Checksum:i384D8E62C63366CA
    GO
    Isoform 10 (identifier: Q8NHW4-10) [UniParc]FASTAAdd to Basket

    Also known as: CC44L2c

    The sequence of this isoform differs from the canonical sequence as follows:
         65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → YRESASSAAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR

    Show »
    Length:103
    Mass (Da):11,008
    Checksum:iDB0F566E66B545F7
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti45 – 451R → H in AAH70310. (PubMed:15489334)Curated

    Polymorphismi

    The copy number of the CC4L1 gene varies among individuals; most individuals have 1 to 6 copies in the diploid genome.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei26 – 9267MGSDP…DLELN → KASKSALTPVSPGSRSTCMT WN in isoform 7. 1 PublicationVSP_032625Add
    BLAST
    Alternative sequencei26 – 9267MGSDP…DLELN → NSKPKEASKSALTPVSPGSR STCMTWN in isoform 8. 1 PublicationVSP_032626Add
    BLAST
    Alternative sequencei26 – 9267MGSDP…DLELN → TKSSEWKLQGVCFQCCSGKD PIHQSCPTWTMVRQRKMPTT GKG in isoform 9. 1 PublicationVSP_032627Add
    BLAST
    Alternative sequencei65 – 9228FQTKR…DLELN → YRESASSAAPGRIPSTRAAP HGPWSGRGRCLPQARDKAR in isoform 10. 1 PublicationVSP_032628Add
    BLAST
    Alternative sequencei65 – 9228FQTKR…DLELN → AAPGRIPSTRAAPHGPWSGR GRCLPQARDKAR in isoform 3. 1 PublicationVSP_032629Add
    BLAST
    Alternative sequencei65 – 9228FQTKR…DLELN → EWKLQGVCFQCCSGKDPIHQ SCPTWTMVRQRKMPTTGKG in isoform 4. 1 PublicationVSP_032630Add
    BLAST
    Alternative sequencei65 – 9228Missing in isoform 5. 2 PublicationsVSP_032631Add
    BLAST
    Alternative sequencei65 – 9228FQTKR…DLELN → AAPHGPWSGRGRCLPQARDK AR in isoform 6. 1 PublicationVSP_032632Add
    BLAST
    Alternative sequencei65 – 695Missing in isoform 2. 1 PublicationVSP_032633

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY079147 Genomic DNA. Translation: AAL87008.1.
    AY766460 Genomic DNA. Translation: AAX07294.1.
    AY766460 Genomic DNA. Translation: AAX07295.1.
    AY766461 Genomic DNA. Translation: AAX07296.1.
    AY766461 Genomic DNA. Translation: AAX07297.1.
    AY766461 Genomic DNA. Translation: AAX07298.1.
    AY766461 Genomic DNA. Translation: AAX07299.1.
    AY766461 Genomic DNA. Translation: AAX07300.1.
    AY766461 Genomic DNA. Translation: AAX07301.1.
    AY766461 Genomic DNA. Translation: AAX07302.1.
    AY766461 Genomic DNA. Translation: AAX07303.1.
    AY766461 Genomic DNA. Translation: AAX07304.1.
    AY766447 mRNA. Translation: AAX07306.1.
    AY766449 mRNA. Translation: AAX07308.1.
    AY766450 mRNA. Translation: AAX07309.1.
    AY766451 mRNA. Translation: AAX07310.1.
    AY766452 mRNA. Translation: AAX07311.1.
    AY766453 mRNA. Translation: AAX07312.1.
    AY766454 mRNA. Translation: AAX07313.1.
    AY766455 mRNA. Translation: AAX07314.1.
    AY766456 mRNA. Translation: AAX07315.1.
    AY766457 mRNA. Translation: AAX07316.1.
    AY766458 mRNA. Translation: AAX07317.1.
    BC070310 mRNA. Translation: AAH70310.1.
    BC092445 mRNA. Translation: AAH92445.1.
    BC130456 mRNA. Translation: AAI30457.1.
    BC130458 mRNA. Translation: AAI30459.1.
    BC144393 mRNA. Translation: AAI44394.1.
    BC144394 mRNA. Translation: AAI44395.1.
    BC171864 mRNA. Translation: AAI71864.1.
    BC146944 mRNA. Translation: AAI46945.1.
    BC146958 mRNA. Translation: AAI46959.1.
    PIRiC60407.
    RefSeqiNP_001278397.1. NM_001291468.1. [Q8NHW4-2]
    NP_001278398.1. NM_001291469.1. [Q8NHW4-5]
    NP_001278399.1. NM_001291470.1. [Q8NHW4-5]
    NP_001278400.1. NM_001291471.1. [Q8NHW4-10]
    NP_001278401.1. NM_001291472.1. [Q8NHW4-3]
    NP_001278402.1. NM_001291473.1. [Q8NHW4-6]
    NP_001278403.1. NM_001291474.1. [Q8NHW4-9]
    NP_001278404.1. NM_001291475.1. [Q8NHW4-4]
    NP_996890.1. NM_207007.3. [Q8NHW4-1]
    UniGeneiHs.449862.
    Hs.515183.

    Genome annotation databases

    GeneIDi388372.
    9560.
    KEGGihsa:388372.
    hsa:9560.
    UCSCiuc002hlw.3. human. [Q8NHW4-1]

    Polymorphism databases

    DMDMi74727347.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY079147 Genomic DNA. Translation: AAL87008.1 .
    AY766460 Genomic DNA. Translation: AAX07294.1 .
    AY766460 Genomic DNA. Translation: AAX07295.1 .
    AY766461 Genomic DNA. Translation: AAX07296.1 .
    AY766461 Genomic DNA. Translation: AAX07297.1 .
    AY766461 Genomic DNA. Translation: AAX07298.1 .
    AY766461 Genomic DNA. Translation: AAX07299.1 .
    AY766461 Genomic DNA. Translation: AAX07300.1 .
    AY766461 Genomic DNA. Translation: AAX07301.1 .
    AY766461 Genomic DNA. Translation: AAX07302.1 .
    AY766461 Genomic DNA. Translation: AAX07303.1 .
    AY766461 Genomic DNA. Translation: AAX07304.1 .
    AY766447 mRNA. Translation: AAX07306.1 .
    AY766449 mRNA. Translation: AAX07308.1 .
    AY766450 mRNA. Translation: AAX07309.1 .
    AY766451 mRNA. Translation: AAX07310.1 .
    AY766452 mRNA. Translation: AAX07311.1 .
    AY766453 mRNA. Translation: AAX07312.1 .
    AY766454 mRNA. Translation: AAX07313.1 .
    AY766455 mRNA. Translation: AAX07314.1 .
    AY766456 mRNA. Translation: AAX07315.1 .
    AY766457 mRNA. Translation: AAX07316.1 .
    AY766458 mRNA. Translation: AAX07317.1 .
    BC070310 mRNA. Translation: AAH70310.1 .
    BC092445 mRNA. Translation: AAH92445.1 .
    BC130456 mRNA. Translation: AAI30457.1 .
    BC130458 mRNA. Translation: AAI30459.1 .
    BC144393 mRNA. Translation: AAI44394.1 .
    BC144394 mRNA. Translation: AAI44395.1 .
    BC171864 mRNA. Translation: AAI71864.1 .
    BC146944 mRNA. Translation: AAI46945.1 .
    BC146958 mRNA. Translation: AAI46959.1 .
    PIRi C60407.
    RefSeqi NP_001278397.1. NM_001291468.1. [Q8NHW4-2 ]
    NP_001278398.1. NM_001291469.1. [Q8NHW4-5 ]
    NP_001278399.1. NM_001291470.1. [Q8NHW4-5 ]
    NP_001278400.1. NM_001291471.1. [Q8NHW4-10 ]
    NP_001278401.1. NM_001291472.1. [Q8NHW4-3 ]
    NP_001278402.1. NM_001291473.1. [Q8NHW4-6 ]
    NP_001278403.1. NM_001291474.1. [Q8NHW4-9 ]
    NP_001278404.1. NM_001291475.1. [Q8NHW4-4 ]
    NP_996890.1. NM_207007.3. [Q8NHW4-1 ]
    UniGenei Hs.449862.
    Hs.515183.

    3D structure databases

    ProteinModelPortali Q8NHW4.
    SMRi Q8NHW4. Positions 27-92.
    ModBasei Search...
    MobiDBi Search...

    Polymorphism databases

    DMDMi 74727347.

    Proteomic databases

    PaxDbi Q8NHW4.
    PRIDEi Q8NHW4.

    Protocols and materials databases

    DNASUi 388372.
    9560.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 388372.
    9560.
    KEGGi hsa:388372.
    hsa:9560.
    UCSCi uc002hlw.3. human. [Q8NHW4-1 ]

    Organism-specific databases

    CTDi 388372.
    GeneCardsi GC17P034538.
    GC17P034639.
    HGNCi HGNC:10631. CCL4L1.
    HGNC:24066. CCL4L2.
    MIMi 603782. gene.
    610757. gene.
    neXtProti NX_Q8NHW4.
    PharmGKBi PA35563.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG124416.
    HOVERGENi HBG017871.
    KOi K12964.
    OMAi PAFSAPI.
    PhylomeDBi Q8NHW4.
    TreeFami TF334888.

    Miscellaneous databases

    NextBioi 102005.
    PROi Q8NHW4.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8NHW4.
    CleanExi HS_CCL4L1.
    Genevestigatori Q8NHW4.

    Family and domain databases

    InterProi IPR000827. Chemokine_CC_CS.
    IPR001811. Chemokine_IL8-like_dom.
    [Graphical view ]
    Pfami PF00048. IL8. 1 hit.
    [Graphical view ]
    SMARTi SM00199. SCY. 1 hit.
    [Graphical view ]
    SUPFAMi SSF54117. SSF54117. 1 hit.
    PROSITEi PS00472. SMALL_CYTOKINES_CC. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Variation in gene copy number of the human chemokines macrophage inflammatory protein-1a/CCL3 and macrophage inflammatory protein-1b/CCL4."
      Nibbs R.J., Barcellos L.F., Townson J.R.
      Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
    2. "Multiple products derived from two CCL4 loci: high incidence of a new polymorphism in HIV+ patients."
      Colobran R., Adreani P., Ashhab Y., Llano A., Este J.A., Dominguez O., Pujol-Borrell R., Juan M.
      J. Immunol. 174:5655-5664(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9 AND 10).
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
      Tissue: Blood and Brain.
    4. "The human MIP-1beta chemokine is encoded by two paralogous genes, ACT-2 and LAG-1."
      Modi W.S., Bergeron J., Sanford M.
      Immunogenetics 53:543-549(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.
    5. "Functional redundancy of the human CCL4 and CCL4L1 chemokine genes."
      Howard O.M.Z., Turpin J.A., Goldman R., Modi W.S.
      Biochem. Biophys. Res. Commun. 320:927-931(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CCR5, GENOMIC DUPLICATION.
    6. "CCL3L1 and CCL4L1 chemokine genes are located in a segmental duplication at chromosome 17q12."
      Modi W.S.
      Genomics 83:735-738(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION, GENOMIC DUPLICATION.
    7. "Independent expression of the two paralogous CCL4 genes in monocytes and B lymphocytes."
      Lu J., Honczarenko M., Sloan S.R.
      Immunogenetics 55:706-711(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    8. "CCL3L1 and CCL4L1: variable gene copy number in adolescents with and without human immunodeficiency virus type 1 (HIV-1) infection."
      Shao W., Tang J., Song W., Wang C., Li Y., Wilson C.M., Kaslow R.A.
      Genes Immun. 8:224-231(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION, POLYMORPHISM OF GENE COPY NUMBER.

    Entry informationi

    Entry nameiCC4L_HUMAN
    AccessioniPrimary (citable) accession number: Q8NHW4
    Secondary accession number(s): B2RUZ3
    , B7ZMA8, Q50EM1, Q50EM2, Q50EM3, Q50EM4, Q50EM5, Q50EM6, Q50EM7, Q50EM8, Q569J2, Q6NSB0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 18, 2008
    Last sequence update: October 1, 2002
    Last modified: October 1, 2014
    This is version 100 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3