SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NHW4

- CC4L_HUMAN

UniProt

Q8NHW4 - CC4L_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

C-C motif chemokine 4-like

Gene
CCL4L1, CCL4L, LAG1, SCYA4L1
CCL4L2, CCL4L, SCYA4L2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Chemokine that induces chemotaxis of cells expressing CCR5 or CCR1. Inhibits HIV replication in peripheral blood monocytes that express CCR5.1 Publication

GO - Biological processi

  1. cell chemotaxis Source: GOC
  2. immune response Source: InterPro
  3. inflammatory response Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Cytokine

Keywords - Biological processi

Chemotaxis, Inflammatory response

Names & Taxonomyi

Organism-specific databases

Protein namesi
Recommended name:
C-C motif chemokine 4-like
Alternative name(s):
Lymphocyte activation gene 1 protein
Short name:
LAG-1
Macrophage inflammatory protein 1-beta
Short name:
MIP-1-beta
Monocyte adherence-induced protein 5-alpha
Small-inducible cytokine A4-like
Gene namesi
Name:CCL4L1
Synonyms:CCL4L, LAG1, SCYA4L1
AND
Name:CCL4L2
Synonyms:CCL4L, SCYA4L2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17
HGNCiHGNC:10631. CCL4L1.
HGNC:24066. CCL4L2.

Subcellular locationi

Secreted By similarity

GO - Cellular componenti

  1. extracellular space Source: UniProtKB-KW

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35563.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2323 By similarityAdd
BLAST
Chaini24 – 9269C-C motif chemokine 4-likePRO_0000326234Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi34 ↔ 58 By similarity
Disulfide bondi35 ↔ 74 By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ8NHW4.
PRIDEiQ8NHW4.

Expressioni

Tissue specificityi

Detected in B-cells.1 Publication

Gene expression databases

BgeeiQ8NHW4.
CleanExiHS_CCL4L1.
GenevestigatoriQ8NHW4.

Interactioni

Subunit structurei

Interacts with CCR5.1 Publication

Structurei

3D structure databases

ProteinModelPortaliQ8NHW4.
SMRiQ8NHW4. Positions 27-92.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG124416.
HOVERGENiHBG017871.
KOiK12964.
OMAiPAFSAPI.
PhylomeDBiQ8NHW4.
TreeFamiTF334888.

Family and domain databases

InterProiIPR000827. Chemokine_CC_CS.
IPR001811. Chemokine_IL8-like_dom.
[Graphical view]
PfamiPF00048. IL8. 1 hit.
[Graphical view]
SMARTiSM00199. SCY. 1 hit.
[Graphical view]
SUPFAMiSSF54117. SSF54117. 1 hit.
PROSITEiPS00472. SMALL_CYTOKINES_CC. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 10 isoformsi produced by alternative splicing. Align

Note: CCL4L1 and CCL4L2 genes differ in their non-coding regions. Thus, alternative splicing events differ between the two genes.

Isoform 1 (identifier: Q8NHW4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKLCVTVLSL LVLVAAFCSL ALSAPMGSDP PTACCFSYTA RKLPRNFVVD   50
YYETSSLCSQ PAVVFQTKRG KQVCADPSES WVQEYVYDLE LN 92
Length:92
Mass (Da):10,166
Last modified:October 1, 2002 - v1
Checksum:i4C8D01E926CDE882
GO
Isoform 2 (identifier: Q8NHW4-2) [UniParc]FASTAAdd to Basket

Also known as: CCL4L2

The sequence of this isoform differs from the canonical sequence as follows:
     65-69: Missing.

Show »
Length:87
Mass (Da):9,505
Checksum:i8140E8AA4D95C05C
GO
Isoform 3 (identifier: Q8NHW4-3) [UniParc]FASTAAdd to Basket

Also known as: CC4L2d

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR

Show »
Length:96
Mass (Da):10,227
Checksum:iCA14E1C6FC2D1745
GO
Isoform 4 (identifier: Q8NHW4-4) [UniParc]FASTAAdd to Basket

Also known as: CC4L2f

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → EWKLQGVCFQCCSGKDPIHQSCPTWTMVRQRKMPTTGKG

Show »
Length:103
Mass (Da):11,286
Checksum:i5603FE25DE1B08E9
GO
Isoform 5 (identifier: Q8NHW4-5) [UniParc]FASTAAdd to Basket

Also known as: CC4L2b1, CC4L2b2

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: Missing.

Show »
Length:64
Mass (Da):6,850
Checksum:i60EA92F22897BEDF
GO
Isoform 6 (identifier: Q8NHW4-6) [UniParc]FASTAAdd to Basket

Also known as: CC4L2e

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPHGPWSGRGRCLPQARDKAR

Show »
Length:86
Mass (Da):9,220
Checksum:iBE0C616BBA0CBDC8
GO
Isoform 7 (identifier: Q8NHW4-7) [UniParc]FASTAAdd to Basket

Also known as: CC4L2d2

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → KASKSALTPVSPGSRSTCMTWN

Show »
Length:47
Mass (Da):4,855
Checksum:iE0D5FB87C91506C9
GO
Isoform 8 (identifier: Q8NHW4-8) [UniParc]FASTAAdd to Basket

Also known as: CC4L1d2

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → NSKPKEASKSALTPVSPGSRSTCMTWN

Show »
Length:52
Mass (Da):5,410
Checksum:iC066A711CE38A507
GO
Isoform 9 (identifier: Q8NHW4-9) [UniParc]FASTAAdd to Basket

Also known as: CC4L2bd2

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → TKSSEWKLQG...QRKMPTTGKG

Show »
Length:68
Mass (Da):7,403
Checksum:i384D8E62C63366CA
GO
Isoform 10 (identifier: Q8NHW4-10) [UniParc]FASTAAdd to Basket

Also known as: CC44L2c

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → YRESASSAAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR

Show »
Length:103
Mass (Da):11,008
Checksum:iDB0F566E66B545F7
GO

Polymorphismi

The copy number of the CC4L1 gene varies among individuals; most individuals have 1 to 6 copies in the diploid genome.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei26 – 9267MGSDP…DLELN → KASKSALTPVSPGSRSTCMT WN in isoform 7. VSP_032625Add
BLAST
Alternative sequencei26 – 9267MGSDP…DLELN → NSKPKEASKSALTPVSPGSR STCMTWN in isoform 8. VSP_032626Add
BLAST
Alternative sequencei26 – 9267MGSDP…DLELN → TKSSEWKLQGVCFQCCSGKD PIHQSCPTWTMVRQRKMPTT GKG in isoform 9. VSP_032627Add
BLAST
Alternative sequencei65 – 9228FQTKR…DLELN → YRESASSAAPGRIPSTRAAP HGPWSGRGRCLPQARDKAR in isoform 10. VSP_032628Add
BLAST
Alternative sequencei65 – 9228FQTKR…DLELN → AAPGRIPSTRAAPHGPWSGR GRCLPQARDKAR in isoform 3. VSP_032629Add
BLAST
Alternative sequencei65 – 9228FQTKR…DLELN → EWKLQGVCFQCCSGKDPIHQ SCPTWTMVRQRKMPTTGKG in isoform 4. VSP_032630Add
BLAST
Alternative sequencei65 – 9228Missing in isoform 5. VSP_032631Add
BLAST
Alternative sequencei65 – 9228FQTKR…DLELN → AAPHGPWSGRGRCLPQARDK AR in isoform 6. VSP_032632Add
BLAST
Alternative sequencei65 – 695Missing in isoform 2. VSP_032633

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti45 – 451R → H in AAH70310. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY079147 Genomic DNA. Translation: AAL87008.1.
AY766460 Genomic DNA. Translation: AAX07294.1.
AY766460 Genomic DNA. Translation: AAX07295.1.
AY766461 Genomic DNA. Translation: AAX07296.1.
AY766461 Genomic DNA. Translation: AAX07297.1.
AY766461 Genomic DNA. Translation: AAX07298.1.
AY766461 Genomic DNA. Translation: AAX07299.1.
AY766461 Genomic DNA. Translation: AAX07300.1.
AY766461 Genomic DNA. Translation: AAX07301.1.
AY766461 Genomic DNA. Translation: AAX07302.1.
AY766461 Genomic DNA. Translation: AAX07303.1.
AY766461 Genomic DNA. Translation: AAX07304.1.
AY766447 mRNA. Translation: AAX07306.1.
AY766449 mRNA. Translation: AAX07308.1.
AY766450 mRNA. Translation: AAX07309.1.
AY766451 mRNA. Translation: AAX07310.1.
AY766452 mRNA. Translation: AAX07311.1.
AY766453 mRNA. Translation: AAX07312.1.
AY766454 mRNA. Translation: AAX07313.1.
AY766455 mRNA. Translation: AAX07314.1.
AY766456 mRNA. Translation: AAX07315.1.
AY766457 mRNA. Translation: AAX07316.1.
AY766458 mRNA. Translation: AAX07317.1.
BC070310 mRNA. Translation: AAH70310.1.
BC092445 mRNA. Translation: AAH92445.1.
BC130456 mRNA. Translation: AAI30457.1.
BC130458 mRNA. Translation: AAI30459.1.
BC144393 mRNA. Translation: AAI44394.1.
BC144394 mRNA. Translation: AAI44395.1.
BC171864 mRNA. Translation: AAI71864.1.
BC146944 mRNA. Translation: AAI46945.1.
BC146958 mRNA. Translation: AAI46959.1.
PIRiC60407.
RefSeqiNP_001278397.1. NM_001291468.1. [Q8NHW4-2]
NP_001278398.1. NM_001291469.1. [Q8NHW4-5]
NP_001278399.1. NM_001291470.1. [Q8NHW4-5]
NP_001278400.1. NM_001291471.1. [Q8NHW4-10]
NP_001278401.1. NM_001291472.1. [Q8NHW4-3]
NP_001278402.1. NM_001291473.1. [Q8NHW4-6]
NP_001278403.1. NM_001291474.1. [Q8NHW4-9]
NP_001278404.1. NM_001291475.1. [Q8NHW4-4]
NP_996890.1. NM_207007.3. [Q8NHW4-1]
UniGeneiHs.449862.
Hs.515183.

Genome annotation databases

EnsembliENST00000339270; ENSP00000345572; ENSG00000197262. [Q8NHW4-8]
ENST00000378350; ENSP00000367601; ENSG00000205020. [Q8NHW4-3]
ENST00000389068; ENSP00000373720; ENSG00000205020. [Q8NHW4-7]
ENST00000394463; ENSP00000377976; ENSG00000197262. [Q8NHW4-6]
ENST00000394465; ENSP00000377978; ENSG00000197262. [Q8NHW4-1]
ENST00000400702; ENSP00000383538; ENSG00000205020. [Q8NHW4-9]
ENST00000444414; ENSP00000405533; ENSG00000205020. [Q8NHW4-1]
ENST00000482104; ENSP00000466965; ENSG00000197262. [Q8NHW4-5]
ENST00000562236; ENSP00000456735; ENSG00000260717. [Q8NHW4-7]
ENST00000563132; ENSP00000458095; ENSG00000260717. [Q8NHW4-6]
ENST00000563802; ENSP00000455820; ENSG00000260717. [Q8NHW4-1]
ENST00000564234; ENSP00000456123; ENSG00000260717. [Q8NHW4-4]
ENST00000567608; ENSP00000455148; ENSG00000260717. [Q8NHW4-5]
ENST00000567807; ENSP00000456156; ENSG00000260717. [Q8NHW4-10]
ENST00000567858; ENSP00000454525; ENSG00000260717. [Q8NHW4-3]
ENST00000569856; ENSP00000456951; ENSG00000260717. [Q8NHW4-2]
ENST00000586598; ENSP00000467658; ENSG00000205020. [Q8NHW4-5]
ENST00000588929; ENSP00000465568; ENSG00000205020. [Q8NHW4-2]
ENST00000589079; ENSP00000466720; ENSG00000205020. [Q8NHW4-10]
ENST00000589336; ENSP00000467722; ENSG00000205020. [Q8NHW4-5]
ENST00000591167; ENSP00000467085; ENSG00000205020. [Q8NHW4-6]
ENST00000591637; ENSP00000468405; ENSG00000205020. [Q8NHW4-4]
GeneIDi388372.
9560.
KEGGihsa:388372.
hsa:9560.
UCSCiuc002hlw.3. human. [Q8NHW4-1]

Polymorphism databases

DMDMi74727347.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY079147 Genomic DNA. Translation: AAL87008.1 .
AY766460 Genomic DNA. Translation: AAX07294.1 .
AY766460 Genomic DNA. Translation: AAX07295.1 .
AY766461 Genomic DNA. Translation: AAX07296.1 .
AY766461 Genomic DNA. Translation: AAX07297.1 .
AY766461 Genomic DNA. Translation: AAX07298.1 .
AY766461 Genomic DNA. Translation: AAX07299.1 .
AY766461 Genomic DNA. Translation: AAX07300.1 .
AY766461 Genomic DNA. Translation: AAX07301.1 .
AY766461 Genomic DNA. Translation: AAX07302.1 .
AY766461 Genomic DNA. Translation: AAX07303.1 .
AY766461 Genomic DNA. Translation: AAX07304.1 .
AY766447 mRNA. Translation: AAX07306.1 .
AY766449 mRNA. Translation: AAX07308.1 .
AY766450 mRNA. Translation: AAX07309.1 .
AY766451 mRNA. Translation: AAX07310.1 .
AY766452 mRNA. Translation: AAX07311.1 .
AY766453 mRNA. Translation: AAX07312.1 .
AY766454 mRNA. Translation: AAX07313.1 .
AY766455 mRNA. Translation: AAX07314.1 .
AY766456 mRNA. Translation: AAX07315.1 .
AY766457 mRNA. Translation: AAX07316.1 .
AY766458 mRNA. Translation: AAX07317.1 .
BC070310 mRNA. Translation: AAH70310.1 .
BC092445 mRNA. Translation: AAH92445.1 .
BC130456 mRNA. Translation: AAI30457.1 .
BC130458 mRNA. Translation: AAI30459.1 .
BC144393 mRNA. Translation: AAI44394.1 .
BC144394 mRNA. Translation: AAI44395.1 .
BC171864 mRNA. Translation: AAI71864.1 .
BC146944 mRNA. Translation: AAI46945.1 .
BC146958 mRNA. Translation: AAI46959.1 .
PIRi C60407.
RefSeqi NP_001278397.1. NM_001291468.1. [Q8NHW4-2 ]
NP_001278398.1. NM_001291469.1. [Q8NHW4-5 ]
NP_001278399.1. NM_001291470.1. [Q8NHW4-5 ]
NP_001278400.1. NM_001291471.1. [Q8NHW4-10 ]
NP_001278401.1. NM_001291472.1. [Q8NHW4-3 ]
NP_001278402.1. NM_001291473.1. [Q8NHW4-6 ]
NP_001278403.1. NM_001291474.1. [Q8NHW4-9 ]
NP_001278404.1. NM_001291475.1. [Q8NHW4-4 ]
NP_996890.1. NM_207007.3. [Q8NHW4-1 ]
UniGenei Hs.449862.
Hs.515183.

3D structure databases

ProteinModelPortali Q8NHW4.
SMRi Q8NHW4. Positions 27-92.
ModBasei Search...
MobiDBi Search...

Polymorphism databases

DMDMi 74727347.

Proteomic databases

PaxDbi Q8NHW4.
PRIDEi Q8NHW4.

Protocols and materials databases

DNASUi 388372.
9560.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000339270 ; ENSP00000345572 ; ENSG00000197262 . [Q8NHW4-8 ]
ENST00000378350 ; ENSP00000367601 ; ENSG00000205020 . [Q8NHW4-3 ]
ENST00000389068 ; ENSP00000373720 ; ENSG00000205020 . [Q8NHW4-7 ]
ENST00000394463 ; ENSP00000377976 ; ENSG00000197262 . [Q8NHW4-6 ]
ENST00000394465 ; ENSP00000377978 ; ENSG00000197262 . [Q8NHW4-1 ]
ENST00000400702 ; ENSP00000383538 ; ENSG00000205020 . [Q8NHW4-9 ]
ENST00000444414 ; ENSP00000405533 ; ENSG00000205020 . [Q8NHW4-1 ]
ENST00000482104 ; ENSP00000466965 ; ENSG00000197262 . [Q8NHW4-5 ]
ENST00000562236 ; ENSP00000456735 ; ENSG00000260717 . [Q8NHW4-7 ]
ENST00000563132 ; ENSP00000458095 ; ENSG00000260717 . [Q8NHW4-6 ]
ENST00000563802 ; ENSP00000455820 ; ENSG00000260717 . [Q8NHW4-1 ]
ENST00000564234 ; ENSP00000456123 ; ENSG00000260717 . [Q8NHW4-4 ]
ENST00000567608 ; ENSP00000455148 ; ENSG00000260717 . [Q8NHW4-5 ]
ENST00000567807 ; ENSP00000456156 ; ENSG00000260717 . [Q8NHW4-10 ]
ENST00000567858 ; ENSP00000454525 ; ENSG00000260717 . [Q8NHW4-3 ]
ENST00000569856 ; ENSP00000456951 ; ENSG00000260717 . [Q8NHW4-2 ]
ENST00000586598 ; ENSP00000467658 ; ENSG00000205020 . [Q8NHW4-5 ]
ENST00000588929 ; ENSP00000465568 ; ENSG00000205020 . [Q8NHW4-2 ]
ENST00000589079 ; ENSP00000466720 ; ENSG00000205020 . [Q8NHW4-10 ]
ENST00000589336 ; ENSP00000467722 ; ENSG00000205020 . [Q8NHW4-5 ]
ENST00000591167 ; ENSP00000467085 ; ENSG00000205020 . [Q8NHW4-6 ]
ENST00000591637 ; ENSP00000468405 ; ENSG00000205020 . [Q8NHW4-4 ]
GeneIDi 388372.
9560.
KEGGi hsa:388372.
hsa:9560.
UCSCi uc002hlw.3. human. [Q8NHW4-1 ]

Organism-specific databases

CTDi 388372.
9560.
GeneCardsi GC17P034538.
GC17P034639.
HGNCi HGNC:10631. CCL4L1.
HGNC:24066. CCL4L2.
MIMi 603782. gene.
610757. gene.
neXtProti NX_Q8NHW4.
PharmGKBi PA35563.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG124416.
HOVERGENi HBG017871.
KOi K12964.
OMAi PAFSAPI.
PhylomeDBi Q8NHW4.
TreeFami TF334888.

Miscellaneous databases

NextBioi 102005.
PROi Q8NHW4.
SOURCEi Search...

Gene expression databases

Bgeei Q8NHW4.
CleanExi HS_CCL4L1.
Genevestigatori Q8NHW4.

Family and domain databases

InterProi IPR000827. Chemokine_CC_CS.
IPR001811. Chemokine_IL8-like_dom.
[Graphical view ]
Pfami PF00048. IL8. 1 hit.
[Graphical view ]
SMARTi SM00199. SCY. 1 hit.
[Graphical view ]
SUPFAMi SSF54117. SSF54117. 1 hit.
PROSITEi PS00472. SMALL_CYTOKINES_CC. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Variation in gene copy number of the human chemokines macrophage inflammatory protein-1a/CCL3 and macrophage inflammatory protein-1b/CCL4."
    Nibbs R.J., Barcellos L.F., Townson J.R.
    Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
  2. "Multiple products derived from two CCL4 loci: high incidence of a new polymorphism in HIV+ patients."
    Colobran R., Adreani P., Ashhab Y., Llano A., Este J.A., Dominguez O., Pujol-Borrell R., Juan M.
    J. Immunol. 174:5655-5664(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9 AND 10).
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
    Tissue: Blood and Brain.
  4. "The human MIP-1beta chemokine is encoded by two paralogous genes, ACT-2 and LAG-1."
    Modi W.S., Bergeron J., Sanford M.
    Immunogenetics 53:543-549(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  5. "Functional redundancy of the human CCL4 and CCL4L1 chemokine genes."
    Howard O.M.Z., Turpin J.A., Goldman R., Modi W.S.
    Biochem. Biophys. Res. Commun. 320:927-931(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CCR5, GENOMIC DUPLICATION.
  6. "CCL3L1 and CCL4L1 chemokine genes are located in a segmental duplication at chromosome 17q12."
    Modi W.S.
    Genomics 83:735-738(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION, GENOMIC DUPLICATION.
  7. "Independent expression of the two paralogous CCL4 genes in monocytes and B lymphocytes."
    Lu J., Honczarenko M., Sloan S.R.
    Immunogenetics 55:706-711(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  8. "CCL3L1 and CCL4L1: variable gene copy number in adolescents with and without human immunodeficiency virus type 1 (HIV-1) infection."
    Shao W., Tang J., Song W., Wang C., Li Y., Wilson C.M., Kaslow R.A.
    Genes Immun. 8:224-231(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION, POLYMORPHISM OF GENE COPY NUMBER.

Entry informationi

Entry nameiCC4L_HUMAN
AccessioniPrimary (citable) accession number: Q8NHW4
Secondary accession number(s): B2RUZ3
, B7ZMA8, Q50EM1, Q50EM2, Q50EM3, Q50EM4, Q50EM5, Q50EM6, Q50EM7, Q50EM8, Q569J2, Q6NSB0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: October 1, 2002
Last modified: September 3, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi