Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NHW4 (CC4L_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 94. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
C-C motif chemokine 4-like
Alternative name(s):
Lymphocyte activation gene 1 protein
Short name=LAG-1
Macrophage inflammatory protein 1-beta
Short name=MIP-1-beta
Monocyte adherence-induced protein 5-alpha
Small-inducible cytokine A4-like
Gene names
Name:CCL4L1
Synonyms:CCL4L, LAG1, SCYA4L1
AND
Name:CCL4L2
Synonyms:CCL4L, SCYA4L2
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length92 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Chemokine that induces chemotaxis of cells expressing CCR5 or CCR1. Inhibits HIV replication in peripheral blood monocytes that express CCR5. Ref.5

Subunit structure

Interacts with CCR5. Ref.5

Subcellular location

Secreted By similarity.

Tissue specificity

Detected in B-cells. Ref.7

Polymorphism

The copy number of the CC4L1 gene varies among individuals; most individuals have 1 to 6 copies in the diploid genome.

Sequence similarities

Belongs to the intercrine beta (chemokine CC) family.

Ontologies

Keywords
   Biological processChemotaxis
Inflammatory response
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
   DomainSignal
   Molecular functionCytokine
   PTMDisulfide bond
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell chemotaxis

Inferred from electronic annotation. Source: GOC

immune response

Inferred from electronic annotation. Source: InterPro

inflammatory response

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentextracellular space

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 10 isoforms produced by alternative splicing. [Align] [Select]

Note: CCL4L1 and CCL4L2 genes differ in their non-coding regions. Thus, alternative splicing events differ between the two genes.
Isoform 1 (identifier: Q8NHW4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8NHW4-2)

Also known as: CCL4L2;

The sequence of this isoform differs from the canonical sequence as follows:
     65-69: Missing.
Isoform 3 (identifier: Q8NHW4-3)

Also known as: CC4L2d;

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR
Isoform 4 (identifier: Q8NHW4-4)

Also known as: CC4L2f;

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → EWKLQGVCFQCCSGKDPIHQSCPTWTMVRQRKMPTTGKG
Isoform 5 (identifier: Q8NHW4-5)

Also known as: CC4L2b1; CC4L2b2;

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: Missing.
Isoform 6 (identifier: Q8NHW4-6)

Also known as: CC4L2e;

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPHGPWSGRGRCLPQARDKAR
Isoform 7 (identifier: Q8NHW4-7)

Also known as: CC4L2d2;

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → KASKSALTPVSPGSRSTCMTWN
Isoform 8 (identifier: Q8NHW4-8)

Also known as: CC4L1d2;

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → NSKPKEASKSALTPVSPGSRSTCMTWN
Isoform 9 (identifier: Q8NHW4-9)

Also known as: CC4L2bd2;

The sequence of this isoform differs from the canonical sequence as follows:
     26-92: MGSDPPTACC...QEYVYDLELN → TKSSEWKLQG...QRKMPTTGKG
Isoform 10 (identifier: Q8NHW4-10)

Also known as: CC44L2c;

The sequence of this isoform differs from the canonical sequence as follows:
     65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → YRESASSAAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2323 By similarity
Chain24 – 9269C-C motif chemokine 4-like
PRO_0000326234

Amino acid modifications

Disulfide bond34 ↔ 58 By similarity
Disulfide bond35 ↔ 74 By similarity

Natural variations

Alternative sequence26 – 9267MGSDP…DLELN → KASKSALTPVSPGSRSTCMT WN in isoform 7.
VSP_032625
Alternative sequence26 – 9267MGSDP…DLELN → NSKPKEASKSALTPVSPGSR STCMTWN in isoform 8.
VSP_032626
Alternative sequence26 – 9267MGSDP…DLELN → TKSSEWKLQGVCFQCCSGKD PIHQSCPTWTMVRQRKMPTT GKG in isoform 9.
VSP_032627
Alternative sequence65 – 9228FQTKR…DLELN → YRESASSAAPGRIPSTRAAP HGPWSGRGRCLPQARDKAR in isoform 10.
VSP_032628
Alternative sequence65 – 9228FQTKR…DLELN → AAPGRIPSTRAAPHGPWSGR GRCLPQARDKAR in isoform 3.
VSP_032629
Alternative sequence65 – 9228FQTKR…DLELN → EWKLQGVCFQCCSGKDPIHQ SCPTWTMVRQRKMPTTGKG in isoform 4.
VSP_032630
Alternative sequence65 – 9228Missing in isoform 5.
VSP_032631
Alternative sequence65 – 9228FQTKR…DLELN → AAPHGPWSGRGRCLPQARDK AR in isoform 6.
VSP_032632
Alternative sequence65 – 695Missing in isoform 2.
VSP_032633

Experimental info

Sequence conflict451R → H in AAH70310. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2002. Version 1.
Checksum: 4C8D01E926CDE882

FASTA9210,166
        10         20         30         40         50         60 
MKLCVTVLSL LVLVAAFCSL ALSAPMGSDP PTACCFSYTA RKLPRNFVVD YYETSSLCSQ 

        70         80         90 
PAVVFQTKRG KQVCADPSES WVQEYVYDLE LN 

« Hide

Isoform 2 (CCL4L2) [UniParc].

Checksum: 8140E8AA4D95C05C
Show »

FASTA879,505
Isoform 3 (CC4L2d) [UniParc].

Checksum: CA14E1C6FC2D1745
Show »

FASTA9610,227
Isoform 4 (CC4L2f) [UniParc].

Checksum: 5603FE25DE1B08E9
Show »

FASTA10311,286
Isoform 5 (CC4L2b1) (CC4L2b2) [UniParc].

Checksum: 60EA92F22897BEDF
Show »

FASTA646,850
Isoform 6 (CC4L2e) [UniParc].

Checksum: BE0C616BBA0CBDC8
Show »

FASTA869,220
Isoform 7 (CC4L2d2) [UniParc].

Checksum: E0D5FB87C91506C9
Show »

FASTA474,855
Isoform 8 (CC4L1d2) [UniParc].

Checksum: C066A711CE38A507
Show »

FASTA525,410
Isoform 9 (CC4L2bd2) [UniParc].

Checksum: 384D8E62C63366CA
Show »

FASTA687,403
Isoform 10 (CC44L2c) [UniParc].

Checksum: DB0F566E66B545F7
Show »

FASTA10311,008

References

« Hide 'large scale' references
[1]"Variation in gene copy number of the human chemokines macrophage inflammatory protein-1a/CCL3 and macrophage inflammatory protein-1b/CCL4."
Nibbs R.J., Barcellos L.F., Townson J.R.
Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
[2]"Multiple products derived from two CCL4 loci: high incidence of a new polymorphism in HIV+ patients."
Colobran R., Adreani P., Ashhab Y., Llano A., Este J.A., Dominguez O., Pujol-Borrell R., Juan M.
J. Immunol. 174:5655-5664(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9 AND 10).
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
Tissue: Blood and Brain.
[4]"The human MIP-1beta chemokine is encoded by two paralogous genes, ACT-2 and LAG-1."
Modi W.S., Bergeron J., Sanford M.
Immunogenetics 53:543-549(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION.
[5]"Functional redundancy of the human CCL4 and CCL4L1 chemokine genes."
Howard O.M.Z., Turpin J.A., Goldman R., Modi W.S.
Biochem. Biophys. Res. Commun. 320:927-931(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH CCR5, GENOMIC DUPLICATION.
[6]"CCL3L1 and CCL4L1 chemokine genes are located in a segmental duplication at chromosome 17q12."
Modi W.S.
Genomics 83:735-738(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION, GENOMIC DUPLICATION.
[7]"Independent expression of the two paralogous CCL4 genes in monocytes and B lymphocytes."
Lu J., Honczarenko M., Sloan S.R.
Immunogenetics 55:706-711(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[8]"CCL3L1 and CCL4L1: variable gene copy number in adolescents with and without human immunodeficiency virus type 1 (HIV-1) infection."
Shao W., Tang J., Song W., Wang C., Li Y., Wilson C.M., Kaslow R.A.
Genes Immun. 8:224-231(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION, POLYMORPHISM OF GENE COPY NUMBER.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY079147 Genomic DNA. Translation: AAL87008.1.
AY766460 Genomic DNA. Translation: AAX07294.1.
AY766460 Genomic DNA. Translation: AAX07295.1.
AY766461 Genomic DNA. Translation: AAX07296.1.
AY766461 Genomic DNA. Translation: AAX07297.1.
AY766461 Genomic DNA. Translation: AAX07298.1.
AY766461 Genomic DNA. Translation: AAX07299.1.
AY766461 Genomic DNA. Translation: AAX07300.1.
AY766461 Genomic DNA. Translation: AAX07301.1.
AY766461 Genomic DNA. Translation: AAX07302.1.
AY766461 Genomic DNA. Translation: AAX07303.1.
AY766461 Genomic DNA. Translation: AAX07304.1.
AY766447 mRNA. Translation: AAX07306.1.
AY766449 mRNA. Translation: AAX07308.1.
AY766450 mRNA. Translation: AAX07309.1.
AY766451 mRNA. Translation: AAX07310.1.
AY766452 mRNA. Translation: AAX07311.1.
AY766453 mRNA. Translation: AAX07312.1.
AY766454 mRNA. Translation: AAX07313.1.
AY766455 mRNA. Translation: AAX07314.1.
AY766456 mRNA. Translation: AAX07315.1.
AY766457 mRNA. Translation: AAX07316.1.
AY766458 mRNA. Translation: AAX07317.1.
BC070310 mRNA. Translation: AAH70310.1.
BC092445 mRNA. Translation: AAH92445.1.
BC130456 mRNA. Translation: AAI30457.1.
BC130458 mRNA. Translation: AAI30459.1.
BC144393 mRNA. Translation: AAI44394.1.
BC144394 mRNA. Translation: AAI44395.1.
BC171864 mRNA. Translation: AAI71864.1.
BC146944 mRNA. Translation: AAI46945.1.
BC146958 mRNA. Translation: AAI46959.1.
PIRC60407.
RefSeqNP_001001435.1. NM_001001435.2.
NP_996890.1. NM_207007.2.
UniGeneHs.449862.
Hs.515183.

3D structure databases

ProteinModelPortalQ8NHW4.
SMRQ8NHW4. Positions 27-92.
ModBaseSearch...
MobiDBSearch...

Proteomic databases

PaxDbQ8NHW4.
PRIDEQ8NHW4.

Protocols and materials databases

DNASU388372.
9560.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000339270; ENSP00000345572; ENSG00000197262. [Q8NHW4-8]
ENST00000378350; ENSP00000367601; ENSG00000205020. [Q8NHW4-3]
ENST00000389068; ENSP00000373720; ENSG00000205020. [Q8NHW4-7]
ENST00000394463; ENSP00000377976; ENSG00000197262. [Q8NHW4-6]
ENST00000394465; ENSP00000377978; ENSG00000197262. [Q8NHW4-1]
ENST00000400702; ENSP00000383538; ENSG00000205020. [Q8NHW4-9]
ENST00000444414; ENSP00000405533; ENSG00000205020. [Q8NHW4-1]
ENST00000482104; ENSP00000466965; ENSG00000197262. [Q8NHW4-5]
ENST00000562236; ENSP00000456735; ENSG00000260717. [Q8NHW4-7]
ENST00000563132; ENSP00000458095; ENSG00000260717. [Q8NHW4-6]
ENST00000563802; ENSP00000455820; ENSG00000260717. [Q8NHW4-1]
ENST00000564234; ENSP00000456123; ENSG00000260717. [Q8NHW4-4]
ENST00000567608; ENSP00000455148; ENSG00000260717. [Q8NHW4-5]
ENST00000567807; ENSP00000456156; ENSG00000260717. [Q8NHW4-10]
ENST00000567858; ENSP00000454525; ENSG00000260717. [Q8NHW4-3]
ENST00000569856; ENSP00000456951; ENSG00000260717. [Q8NHW4-2]
ENST00000586598; ENSP00000467658; ENSG00000205020. [Q8NHW4-5]
ENST00000588929; ENSP00000465568; ENSG00000205020. [Q8NHW4-2]
ENST00000589079; ENSP00000466720; ENSG00000205020. [Q8NHW4-10]
ENST00000589336; ENSP00000467722; ENSG00000205020. [Q8NHW4-5]
ENST00000591167; ENSP00000467085; ENSG00000205020. [Q8NHW4-6]
ENST00000591637; ENSP00000468405; ENSG00000205020. [Q8NHW4-4]
GeneID388372.
9560.
KEGGhsa:388372.
hsa:9560.
UCSCuc002hlw.3. human. [Q8NHW4-1]

Organism-specific databases

CTD388372.
9560.
GeneCardsGC17P034538.
GC17P034639.
HGNCHGNC:10631. CCL4L1.
HGNC:24066. CCL4L2.
MIM603782. gene.
610757. gene.
neXtProtNX_Q8NHW4.
PharmGKBPA35563.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG124416.
HOVERGENHBG017871.
KOK12964.
OMAPAFSAPI.
PhylomeDBQ8NHW4.
TreeFamTF334888.

Gene expression databases

ArrayExpressQ8NHW4.
BgeeQ8NHW4.
CleanExHS_CCL4L1.
GenevestigatorQ8NHW4.

Family and domain databases

InterProIPR000827. Chemokine_CC_CS.
IPR001811. Chemokine_IL8-like_dom.
[Graphical view]
PfamPF00048. IL8. 1 hit.
[Graphical view]
SMARTSM00199. SCY. 1 hit.
[Graphical view]
SUPFAMSSF54117. SSF54117. 1 hit.
PROSITEPS00472. SMALL_CYTOKINES_CC. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio102005.
PROQ8NHW4.
SOURCESearch...

Entry information

Entry nameCC4L_HUMAN
AccessionPrimary (citable) accession number: Q8NHW4
Secondary accession number(s): B2RUZ3 expand/collapse secondary AC list , B7ZMA8, Q50EM1, Q50EM2, Q50EM3, Q50EM4, Q50EM5, Q50EM6, Q50EM7, Q50EM8, Q569J2, Q6NSB0
Entry history
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: October 1, 2002
Last modified: March 19, 2014
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM