Q8NHW4 (CC4L_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 86.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: C-C motif chemokine 4-like Alternative name(s): Lymphocyte activation gene 1 protein Short name=LAG-1 Macrophage inflammatory protein 1-beta Short name=MIP-1-beta Monocyte adherence-induced protein 5-alpha Small-inducible cytokine A4-like | |||||||||
| Gene names |
| |||||||||
| Organism | Homo sapiens (Human) [Reference proteome] | |||||||||
| Taxonomic identifier | 9606 [NCBI] | |||||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 92 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Chemokine that induces chemotaxis of cells expressing CCR5 or CCR1. Inhibits HIV replication in peripheral blood monocytes that express CCR5. Ref.5 |
| Subunit structure | Interacts with CCR5. Ref.5 |
| Subcellular location | Secreted By similarity. |
| Tissue specificity | Detected in B-cells. Ref.7 |
| Polymorphism | The copy number of the CC4L1 gene varies among individuals; most individuals have 1 to 6 copies in the diploid genome. |
| Sequence similarities | Belongs to the intercrine beta (chemokine CC) family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Chemotaxis Inflammatory response |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Molecular function | Cytokine |
| PTM | Disulfide bond |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | chemotaxis Inferred from electronic annotation. Source: UniProtKB-KW immune responseInferred from electronic annotation. Source: InterPro inflammatory responseInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | extracellular space Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 10 isoforms produced by alternative splicing. [Align] [Select] Note: CCL4L1 and CCL4L2 genes differ in their non-coding regions. Thus, alternative splicing events differ between the two genes. | ||||||
| Isoform 1 (identifier: Q8NHW4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NHW4-2) Also known as: CCL4L2; The sequence of this isoform differs from the canonical sequence as follows: 65-69: Missing. | ||||||
| Isoform 3 (identifier: Q8NHW4-3) Also known as: CC4L2d; The sequence of this isoform differs from the canonical sequence as follows: 65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR | ||||||
| Isoform 4 (identifier: Q8NHW4-4) Also known as: CC4L2f; The sequence of this isoform differs from the canonical sequence as follows: 65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → EWKLQGVCFQCCSGKDPIHQSCPTWTMVRQRKMPTTGKG | ||||||
| Isoform 5 (identifier: Q8NHW4-5) Also known as: CC4L2b1; CC4L2b2; The sequence of this isoform differs from the canonical sequence as follows: 65-92: Missing. | ||||||
| Isoform 6 (identifier: Q8NHW4-6) Also known as: CC4L2e; The sequence of this isoform differs from the canonical sequence as follows: 65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → AAPHGPWSGRGRCLPQARDKAR | ||||||
| Isoform 7 (identifier: Q8NHW4-7) Also known as: CC4L2d2; The sequence of this isoform differs from the canonical sequence as follows: 26-92: MGSDPPTACC...QEYVYDLELN → KASKSALTPVSPGSRSTCMTWN | ||||||
| Isoform 8 (identifier: Q8NHW4-8) Also known as: CC4L1d2; The sequence of this isoform differs from the canonical sequence as follows: 26-92: MGSDPPTACC...QEYVYDLELN → NSKPKEASKSALTPVSPGSRSTCMTWN | ||||||
| Isoform 9 (identifier: Q8NHW4-9) Also known as: CC4L2bd2; The sequence of this isoform differs from the canonical sequence as follows: 26-92: MGSDPPTACC...QEYVYDLELN → TKSSEWKLQG...QRKMPTTGKG | ||||||
| Isoform 10 (identifier: Q8NHW4-10) Also known as: CC44L2c; The sequence of this isoform differs from the canonical sequence as follows: 65-92: FQTKRGKQVCADPSESWVQEYVYDLELN → YRESASSAAPGRIPSTRAAPHGPWSGRGRCLPQARDKAR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 23 | 23 | By similarity | ||||||||
| Chain | 24 – 92 | 69 | C-C motif chemokine 4-like | PRO_0000326234 | |||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 34 ↔ 58 | By similarity | |||||||||
| Disulfide bond | 35 ↔ 74 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 26 – 92 | 67 | MGSDP…DLELN → KASKSALTPVSPGSRSTCMT WN in isoform 7. | VSP_032625 | |||||||
| Alternative sequence | 26 – 92 | 67 | MGSDP…DLELN → NSKPKEASKSALTPVSPGSR STCMTWN in isoform 8. | VSP_032626 | |||||||
| Alternative sequence | 26 – 92 | 67 | MGSDP…DLELN → TKSSEWKLQGVCFQCCSGKD PIHQSCPTWTMVRQRKMPTT GKG in isoform 9. | VSP_032627 | |||||||
| Alternative sequence | 65 – 92 | 28 | FQTKR…DLELN → YRESASSAAPGRIPSTRAAP HGPWSGRGRCLPQARDKAR in isoform 10. | VSP_032628 | |||||||
| Alternative sequence | 65 – 92 | 28 | FQTKR…DLELN → AAPGRIPSTRAAPHGPWSGR GRCLPQARDKAR in isoform 3. | VSP_032629 | |||||||
| Alternative sequence | 65 – 92 | 28 | FQTKR…DLELN → EWKLQGVCFQCCSGKDPIHQ SCPTWTMVRQRKMPTTGKG in isoform 4. | VSP_032630 | |||||||
| Alternative sequence | 65 – 92 | 28 | Missing in isoform 5. | VSP_032631 | |||||||
| Alternative sequence | 65 – 92 | 28 | FQTKR…DLELN → AAPHGPWSGRGRCLPQARDK AR in isoform 6. | VSP_032632 | |||||||
| Alternative sequence | 65 – 69 | 5 | Missing in isoform 2. | VSP_032633 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 45 | 1 | R → H in AAH70310. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Variation in gene copy number of the human chemokines macrophage inflammatory protein-1a/CCL3 and macrophage inflammatory protein-1b/CCL4." Nibbs R.J., Barcellos L.F., Townson J.R. Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). |
| [2] | "Multiple products derived from two CCL4 loci: high incidence of a new polymorphism in HIV+ patients." Colobran R., Adreani P., Ashhab Y., Llano A., Este J.A., Dominguez O., Pujol-Borrell R., Juan M. J. Immunol. 174:5655-5664(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9 AND 10). |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5). Tissue: Blood and Brain. |
| [4] | "The human MIP-1beta chemokine is encoded by two paralogous genes, ACT-2 and LAG-1." Modi W.S., Bergeron J., Sanford M. Immunogenetics 53:543-549(2001) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION. |
| [5] | "Functional redundancy of the human CCL4 and CCL4L1 chemokine genes." Howard O.M.Z., Turpin J.A., Goldman R., Modi W.S. Biochem. Biophys. Res. Commun. 320:927-931(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CCR5, GENOMIC DUPLICATION. |
| [6] | "CCL3L1 and CCL4L1 chemokine genes are located in a segmental duplication at chromosome 17q12." Modi W.S. Genomics 83:735-738(2004) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION, GENOMIC DUPLICATION. |
| [7] | "Independent expression of the two paralogous CCL4 genes in monocytes and B lymphocytes." Lu J., Honczarenko M., Sloan S.R. Immunogenetics 55:706-711(2004) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [8] | "CCL3L1 and CCL4L1: variable gene copy number in adolescents with and without human immunodeficiency virus type 1 (HIV-1) infection." Shao W., Tang J., Song W., Wang C., Li Y., Wilson C.M., Kaslow R.A. Genes Immun. 8:224-231(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION, POLYMORPHISM OF GENE COPY NUMBER. |
| + | Additional computationally mapped references. |
Cross-references
Entry information
| Entry name | CC4L_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NHW4 Secondary accession number(s): B2RUZ3 Q6NSB0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
