Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NHU2 (CT026_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 94. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Uncharacterized protein C20orf26
Gene names
Name:C20orf26
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1237 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence caution

The sequence CAI42114.1 differs from that shown. Reason: Erroneous gene model prediction.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q8NHU2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 3 (identifier: Q8NHU2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     463-470: SINIRFAT → NICLGRSS
     471-1237: Missing.
Isoform 4 (identifier: Q8NHU2-4)

The sequence of this isoform differs from the canonical sequence as follows:
     343-402: Missing.
Isoform 5 (identifier: Q8NHU2-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-644: Missing.
     835-844: GNIIVYGNTI → DGGRASVLFC
     845-1237: Missing.
Note: Created from a fragment entry and may await further characterization.
Isoform 6 (identifier: Q8NHU2-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-644: Missing.
     933-964: MFFSFCEKNVDYETFKALNDACLVYDSRLVID → GAFFLGLTIICILPSLPFQLPWRYKWHSLIMV
     965-1237: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 12371237Uncharacterized protein C20orf26
PRO_0000079417

Natural variations

Alternative sequence1 – 644644Missing in isoform 5 and isoform 6.
VSP_003802
Alternative sequence343 – 40260Missing in isoform 4.
VSP_003798
Alternative sequence463 – 4708SINIRFAT → NICLGRSS in isoform 3.
VSP_003799
Alternative sequence471 – 1237767Missing in isoform 3.
VSP_003800
Alternative sequence835 – 84410GNIIVYGNTI → DGGRASVLFC in isoform 5.
VSP_003803
Alternative sequence845 – 1237393Missing in isoform 5.
VSP_003804
Alternative sequence933 – 96432MFFSF…RLVID → GAFFLGLTIICILPSLPFQL PWRYKWHSLIMV in isoform 6.
VSP_013682
Alternative sequence965 – 1237273Missing in isoform 6.
VSP_013683
Natural variant741P → R. Ref.4
Corresponds to variant rs17852602 [ dbSNP | Ensembl ].
VAR_027981
Natural variant2541H → R.
Corresponds to variant rs6075614 [ dbSNP | Ensembl ].
VAR_027982
Natural variant3691V → I. Ref.4
Corresponds to variant rs6081901 [ dbSNP | Ensembl ].
VAR_027983
Natural variant3711P → L.
Corresponds to variant rs6075628 [ dbSNP | Ensembl ].
VAR_027984
Natural variant5051D → E.
Corresponds to variant rs7344530 [ dbSNP | Ensembl ].
VAR_027985
Natural variant6601P → L.
Corresponds to variant rs6081930 [ dbSNP | Ensembl ].
VAR_027986
Natural variant6711V → I.
Corresponds to variant rs6046740 [ dbSNP | Ensembl ].
VAR_027987
Natural variant7901T → P. Ref.6
VAR_069396

Experimental info

Sequence conflict6501N → S in AAH31674. Ref.4
Isoform 6:
Sequence conflict1231L → P in BAB71452. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 17, 2006. Version 3.
Checksum: F10E9802BFAC8956

FASTA1,237141,349
        10         20         30         40         50         60 
MSVLTSPRGK VEVVHCRRTE SQDVYCIKSL IRKFTCKLFG KLNIIYLLEK ANLAVTLCND 

        70         80         90        100        110        120 
KEEIMAQATF LDYPNWNVAK QDDWVSVFRE LDSDIPCTPL NTLFMHLFVA VDEYSVGCCK 

       130        140        150        160        170        180 
EILRTVYKAV PELHFIFLIV PSYMSLGSTL ITVFDQVGNI PCLTYEEDFA VHICHRHSHY 

       190        200        210        220        230        240 
PQLHVRKARV EDHDDLMPIF MRYDTILKET YGEYFLAELI EAQDEENHAV VCEVEGTAVG 

       250        260        270        280        290        300 
FMSVCSRVNM QLLHECFDLG PFHGLCFPHP DDVLESPQDL SVRRSQDAEL RSSSQGSQKI 

       310        320        330        340        350        360 
VEELQEPVSP DTMENIQGNI AREAASEEAL TAVQSGNVSE PEDIEKLSDI STGYAQYHHV 

       370        380        390        400        410        420 
SSRSLASLVL PEEPVHFRPI YRGASAAFCI QLFCIDEKYE ARSLDFMNFV FSLFSDKNFC 

       430        440        450        460        470        480 
VISLPHLTPE FFLIQNFVKM VPFNTCTLEQ DLYVFHRAGL LKSINIRFAT LLDTPGVENL 

       490        500        510        520        530        540 
VSTLMLNKSI LEDLDRYNKA RKDPDGTLLQ AFVAEVAEQI VGIAVIRNEM DIEYIRSHYN 

       550        560        570        580        590        600 
IEDFIYFSHH QREEHGHMHH FALNPIFRHY TKFFLKEILR LGFKSCLYYR VYPKSREGKF 

       610        620        630        640        650        660 
QNPYAHSLTS ALHYLVPVRP RRQIVYPLEK LGINAPSKAV SKDPMSYALN HTNRKLTLEP 

       670        680        690        700        710        720 
KITVNAKIIV VGASSVGISF LETLVFCSHM KFNNLTLIST HGLPGKKLLD TEQRKFLASD 

       730        740        750        760        770        780 
HCFNDKDYAL MSLCSWVNVV VGRMTGIDRA AKHVVLSTDE IVPYDHLILC TGQQYQVPCP 

       790        800        810        820        830        840 
TEADISQHLT NREVPNSSQR RYTGKVPCNH FTLNEEEDCF KALIWIRNNS ITTEGNIIVY 

       850        860        870        880        890        900 
GNTIDTYTTV ETLLNLGVSG SRIHLVQPPP ASTITCINNY SVESAVADAL GAAGVTMYRD 

       910        920        930        940        950        960 
AILAQWNDGL HPDPIYSASF TTPTKPFRLQ CSMFFSFCEK NVDYETFKAL NDACLVYDSR 

       970        980        990       1000       1010       1020 
LVIDTNFHTN DIAIRAAGSL TKFSNRYYSN EWTHSNFSSK EIGFQLAAAM LHLFDPTLEP 

      1030       1040       1050       1060       1070       1080 
VTEPPANLDR LIPMYKGAKI QGGILPGSYH YLHIAKPAIP TPLEVQMAQP NYGLELVTGS 

      1090       1100       1110       1120       1130       1140 
AKNGTYFRIH INKYKMVETI TCLSREPFPA SNYIRLFGQH EQLLNNLCAR YDENLITDLY 

      1150       1160       1170       1180       1190       1200 
SYFTEPWCLA LFHDRFIDLR KELRQILASK EEEDLPSIEQ LAHQIEDEEI NPTEKPRQYL 

      1210       1220       1230 
KRVFEESIYK TLVERSTLDY LHYNRYHLPM YAWPGIV 

« Hide

Isoform 3 [UniParc].

Checksum: 0DFF08A0D16B1034
Show »

FASTA47053,551
Isoform 4 [UniParc].

Checksum: E5459E025C959DAE
Show »

FASTA1,177134,537
Isoform 5 [UniParc].

Checksum: 4C38A05D39B1979C
Show »

FASTA20022,433
Isoform 6 [UniParc].

Checksum: CF8979E3AE27B7B5
Show »

FASTA32035,610

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
Tissue: Testis.
[2]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Testis.
[3]"The DNA sequence and comparative analysis of human chromosome 20."
Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. expand/collapse author list , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), VARIANTS ARG-74 AND ILE-369.
Tissue: Brain and Testis.
[5]"The WashU-Merck EST project."
Hillier L., Clark N., Dubuque T., Elliston K., Hawkins M., Holman M., Hultman M., Kucaba T., Le M., Lennon G., Marra M., Parsons J., Rifkin L., Rohlfing T., Soares M., Tan F., Trevaskis E., Waterston R. expand/collapse author list , Williamson A., Wohldmann P., Wilson R.
Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE OF 287-409 (ISOFORM 4).
[6]"Diagnostic exome sequencing in persons with severe intellectual disability."
de Ligt J., Willemsen M.H., van Bon B.W., Kleefstra T., Yntema H.G., Kroes T., Vulto-van Silfhout A.T., Koolen D.A., de Vries P., Gilissen C., del Rosario M., Hoischen A., Scheffer H., de Vries B.B., Brunner H.G., Veltman J.A., Vissers L.E.
N. Engl. J. Med. 367:1921-1929(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT PRO-790.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK057364 mRNA. Translation: BAB71452.1.
AL117439 mRNA. Translation: CAB55925.1.
AL121721 expand/collapse EMBL AC list , AL035454, AL049648, AL161658 Genomic DNA. Translation: CAI19156.1.
AL121721, AL049648 Genomic DNA. Translation: CAI19157.1.
AL049648, AL121721 Genomic DNA. Translation: CAI42254.1.
AL035454 expand/collapse EMBL AC list , AL049648, AL121721, AL161658 Genomic DNA. Translation: CAI42114.1. Sequence problems.
AL049648 expand/collapse EMBL AC list , AL035454, AL121721, AL161658 Genomic DNA. Translation: CAI42250.1.
AL161658 expand/collapse EMBL AC list , AL035454, AL049648, AL121721 Genomic DNA. Translation: CAI40813.1.
BC028708 mRNA. Translation: AAH28708.2.
BC031674 mRNA. Translation: AAH31674.1.
CCDSCCDS33447.1. [Q8NHU2-1]
CCDS54452.1. [Q8NHU2-3]
RefSeqNP_001161288.1. NM_001167816.1. [Q8NHU2-3]
NP_056400.3. NM_015585.3. [Q8NHU2-1]
XP_005260746.1. XM_005260689.2. [Q8NHU2-1]
UniGeneHs.729168.

3D structure databases

ProteinModelPortalQ8NHU2.
SMRQ8NHU2. Positions 837-867.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117532. 1 interaction.
IntActQ8NHU2. 1 interaction.
MINTMINT-7970708.

PTM databases

PhosphoSiteQ8NHU2.

Polymorphism databases

DMDM116241319.

Proteomic databases

MaxQBQ8NHU2.
PaxDbQ8NHU2.
PRIDEQ8NHU2.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000245957; ENSP00000245957; ENSG00000089101. [Q8NHU2-1]
ENST00000377293; ENSP00000366508; ENSG00000089101. [Q8NHU2-5]
ENST00000377306; ENSP00000366521; ENSG00000089101. [Q8NHU2-3]
ENST00000377308; ENSP00000366523; ENSG00000089101. [Q8NHU2-6]
ENST00000377309; ENSP00000366524; ENSG00000089101. [Q8NHU2-6]
ENST00000389656; ENSP00000374307; ENSG00000089101. [Q8NHU2-5]
ENST00000451767; ENSP00000414537; ENSG00000089101. [Q8NHU2-3]
GeneID26074.
KEGGhsa:26074.
UCSCuc002wru.3. human. [Q8NHU2-1]
uc002wrv.3. human. [Q8NHU2-5]
uc010gcw.2. human. [Q8NHU2-3]

Organism-specific databases

CTD26074.
GeneCardsGC20P020033.
H-InvDBHIX0015679.
HGNCHGNC:15872. C20orf26.
HPAHPA009079.
neXtProtNX_Q8NHU2.
PharmGKBPA25741.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG72837.
HOVERGENHBG081363.
OMAPQLHVRK.
OrthoDBEOG7KSX7P.
PhylomeDBQ8NHU2.
TreeFamTF323897.

Gene expression databases

ArrayExpressQ8NHU2.
BgeeQ8NHU2.
CleanExHS_C20orf26.
GenevestigatorQ8NHU2.

Family and domain databases

Gene3D3.40.630.30. 1 hit.
InterProIPR016181. Acyl_CoA_acyltransferase.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSC20orf26. human.
GenomeRNAi26074.
NextBio47987.

Entry information

Entry nameCT026_HUMAN
AccessionPrimary (citable) accession number: Q8NHU2
Secondary accession number(s): A6NHA1 expand/collapse secondary AC list , Q5JXV4, Q5TE18, Q8N5R9, Q96M59, Q9BQL2, Q9H127, Q9H128, Q9NQH4, Q9UFV8, Q9Y4V7
Entry history
Integrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: October 17, 2006
Last modified: July 9, 2014
This is version 94 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 20

Human chromosome 20: entries, gene names and cross-references to MIM