Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NHU2

- CT026_HUMAN

UniProt

Q8NHU2 - CT026_HUMAN

Protein

Uncharacterized protein C20orf26

Gene

C20orf26

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 95 (01 Oct 2014)
      Sequence version 3 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Uncharacterized protein C20orf26
    Gene namesi
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 20

    Organism-specific databases

    HGNCiHGNC:15872. C20orf26.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25741.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12371237Uncharacterized protein C20orf26PRO_0000079417Add
    BLAST

    Proteomic databases

    MaxQBiQ8NHU2.
    PaxDbiQ8NHU2.
    PRIDEiQ8NHU2.

    PTM databases

    PhosphoSiteiQ8NHU2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8NHU2.
    BgeeiQ8NHU2.
    CleanExiHS_C20orf26.
    GenevestigatoriQ8NHU2.

    Organism-specific databases

    HPAiHPA009079.

    Interactioni

    Protein-protein interaction databases

    BioGridi117532. 1 interaction.
    IntActiQ8NHU2. 1 interaction.
    MINTiMINT-7970708.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NHU2.
    SMRiQ8NHU2. Positions 837-867.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Phylogenomic databases

    eggNOGiNOG72837.
    HOVERGENiHBG081363.
    OMAiPQLHVRK.
    OrthoDBiEOG7KSX7P.
    PhylomeDBiQ8NHU2.
    TreeFamiTF323897.

    Family and domain databases

    Gene3Di3.40.630.30. 1 hit.
    InterProiIPR016181. Acyl_CoA_acyltransferase.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Note: Experimental confirmation may be lacking for some isoforms.

    Isoform 1 (identifier: Q8NHU2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSVLTSPRGK VEVVHCRRTE SQDVYCIKSL IRKFTCKLFG KLNIIYLLEK     50
    ANLAVTLCND KEEIMAQATF LDYPNWNVAK QDDWVSVFRE LDSDIPCTPL 100
    NTLFMHLFVA VDEYSVGCCK EILRTVYKAV PELHFIFLIV PSYMSLGSTL 150
    ITVFDQVGNI PCLTYEEDFA VHICHRHSHY PQLHVRKARV EDHDDLMPIF 200
    MRYDTILKET YGEYFLAELI EAQDEENHAV VCEVEGTAVG FMSVCSRVNM 250
    QLLHECFDLG PFHGLCFPHP DDVLESPQDL SVRRSQDAEL RSSSQGSQKI 300
    VEELQEPVSP DTMENIQGNI AREAASEEAL TAVQSGNVSE PEDIEKLSDI 350
    STGYAQYHHV SSRSLASLVL PEEPVHFRPI YRGASAAFCI QLFCIDEKYE 400
    ARSLDFMNFV FSLFSDKNFC VISLPHLTPE FFLIQNFVKM VPFNTCTLEQ 450
    DLYVFHRAGL LKSINIRFAT LLDTPGVENL VSTLMLNKSI LEDLDRYNKA 500
    RKDPDGTLLQ AFVAEVAEQI VGIAVIRNEM DIEYIRSHYN IEDFIYFSHH 550
    QREEHGHMHH FALNPIFRHY TKFFLKEILR LGFKSCLYYR VYPKSREGKF 600
    QNPYAHSLTS ALHYLVPVRP RRQIVYPLEK LGINAPSKAV SKDPMSYALN 650
    HTNRKLTLEP KITVNAKIIV VGASSVGISF LETLVFCSHM KFNNLTLIST 700
    HGLPGKKLLD TEQRKFLASD HCFNDKDYAL MSLCSWVNVV VGRMTGIDRA 750
    AKHVVLSTDE IVPYDHLILC TGQQYQVPCP TEADISQHLT NREVPNSSQR 800
    RYTGKVPCNH FTLNEEEDCF KALIWIRNNS ITTEGNIIVY GNTIDTYTTV 850
    ETLLNLGVSG SRIHLVQPPP ASTITCINNY SVESAVADAL GAAGVTMYRD 900
    AILAQWNDGL HPDPIYSASF TTPTKPFRLQ CSMFFSFCEK NVDYETFKAL 950
    NDACLVYDSR LVIDTNFHTN DIAIRAAGSL TKFSNRYYSN EWTHSNFSSK 1000
    EIGFQLAAAM LHLFDPTLEP VTEPPANLDR LIPMYKGAKI QGGILPGSYH 1050
    YLHIAKPAIP TPLEVQMAQP NYGLELVTGS AKNGTYFRIH INKYKMVETI 1100
    TCLSREPFPA SNYIRLFGQH EQLLNNLCAR YDENLITDLY SYFTEPWCLA 1150
    LFHDRFIDLR KELRQILASK EEEDLPSIEQ LAHQIEDEEI NPTEKPRQYL 1200
    KRVFEESIYK TLVERSTLDY LHYNRYHLPM YAWPGIV 1237
    Length:1,237
    Mass (Da):141,349
    Last modified:October 17, 2006 - v3
    Checksum:iF10E9802BFAC8956
    GO
    Isoform 3 (identifier: Q8NHU2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         463-470: SINIRFAT → NICLGRSS
         471-1237: Missing.

    Show »
    Length:470
    Mass (Da):53,551
    Checksum:i0DFF08A0D16B1034
    GO
    Isoform 4 (identifier: Q8NHU2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         343-402: Missing.

    Show »
    Length:1,177
    Mass (Da):134,537
    Checksum:iE5459E025C959DAE
    GO
    Isoform 5 (identifier: Q8NHU2-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-644: Missing.
         835-844: GNIIVYGNTI → DGGRASVLFC
         845-1237: Missing.

    Note: Created from a fragment entry and may await further characterization.

    Show »
    Length:200
    Mass (Da):22,433
    Checksum:i4C38A05D39B1979C
    GO
    Isoform 6 (identifier: Q8NHU2-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-644: Missing.
         933-964: MFFSFCEKNVDYETFKALNDACLVYDSRLVID → GAFFLGLTIICILPSLPFQLPWRYKWHSLIMV
         965-1237: Missing.

    Show »
    Length:320
    Mass (Da):35,610
    Checksum:iCF8979E3AE27B7B5
    GO

    Sequence cautioni

    The sequence CAI42114.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti650 – 6501N → S in AAH31674. (PubMed:15489334)Curated
    Isoform 6 (identifier: Q8NHU2-6)
    Sequence conflicti123 – 1231L → P in BAB71452. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti74 – 741P → R.1 Publication
    Corresponds to variant rs17852602 [ dbSNP | Ensembl ].
    VAR_027981
    Natural varianti254 – 2541H → R.
    Corresponds to variant rs6075614 [ dbSNP | Ensembl ].
    VAR_027982
    Natural varianti369 – 3691V → I.1 Publication
    Corresponds to variant rs6081901 [ dbSNP | Ensembl ].
    VAR_027983
    Natural varianti371 – 3711P → L.
    Corresponds to variant rs6075628 [ dbSNP | Ensembl ].
    VAR_027984
    Natural varianti505 – 5051D → E.
    Corresponds to variant rs7344530 [ dbSNP | Ensembl ].
    VAR_027985
    Natural varianti660 – 6601P → L.
    Corresponds to variant rs6081930 [ dbSNP | Ensembl ].
    VAR_027986
    Natural varianti671 – 6711V → I.
    Corresponds to variant rs6046740 [ dbSNP | Ensembl ].
    VAR_027987
    Natural varianti790 – 7901T → P.1 Publication
    VAR_069396

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 644644Missing in isoform 5 and isoform 6. 2 PublicationsVSP_003802Add
    BLAST
    Alternative sequencei343 – 40260Missing in isoform 4. CuratedVSP_003798Add
    BLAST
    Alternative sequencei463 – 4708SINIRFAT → NICLGRSS in isoform 3. 1 PublicationVSP_003799
    Alternative sequencei471 – 1237767Missing in isoform 3. 1 PublicationVSP_003800Add
    BLAST
    Alternative sequencei835 – 84410GNIIVYGNTI → DGGRASVLFC in isoform 5. 1 PublicationVSP_003803
    Alternative sequencei845 – 1237393Missing in isoform 5. 1 PublicationVSP_003804Add
    BLAST
    Alternative sequencei933 – 96432MFFSF…RLVID → GAFFLGLTIICILPSLPFQL PWRYKWHSLIMV in isoform 6. 1 PublicationVSP_013682Add
    BLAST
    Alternative sequencei965 – 1237273Missing in isoform 6. 1 PublicationVSP_013683Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK057364 mRNA. Translation: BAB71452.1.
    AL117439 mRNA. Translation: CAB55925.1.
    AL121721
    , AL035454, AL049648, AL161658 Genomic DNA. Translation: CAI19156.1.
    AL121721, AL049648 Genomic DNA. Translation: CAI19157.1.
    AL049648, AL121721 Genomic DNA. Translation: CAI42254.1.
    AL035454
    , AL049648, AL121721, AL161658 Genomic DNA. Translation: CAI42114.1. Sequence problems.
    AL049648
    , AL035454, AL121721, AL161658 Genomic DNA. Translation: CAI42250.1.
    AL161658
    , AL035454, AL049648, AL121721 Genomic DNA. Translation: CAI40813.1.
    BC028708 mRNA. Translation: AAH28708.2.
    BC031674 mRNA. Translation: AAH31674.1.
    CCDSiCCDS33447.1. [Q8NHU2-1]
    CCDS54452.1. [Q8NHU2-3]
    RefSeqiNP_001161288.1. NM_001167816.1. [Q8NHU2-3]
    NP_056400.3. NM_015585.3. [Q8NHU2-1]
    XP_005260746.1. XM_005260689.2. [Q8NHU2-1]
    UniGeneiHs.729168.

    Genome annotation databases

    EnsembliENST00000245957; ENSP00000245957; ENSG00000089101. [Q8NHU2-1]
    ENST00000377293; ENSP00000366508; ENSG00000089101. [Q8NHU2-5]
    ENST00000377306; ENSP00000366521; ENSG00000089101. [Q8NHU2-3]
    ENST00000377308; ENSP00000366523; ENSG00000089101. [Q8NHU2-6]
    ENST00000389656; ENSP00000374307; ENSG00000089101. [Q8NHU2-5]
    ENST00000451767; ENSP00000414537; ENSG00000089101. [Q8NHU2-3]
    GeneIDi26074.
    KEGGihsa:26074.
    UCSCiuc002wru.3. human. [Q8NHU2-1]
    uc002wrv.3. human. [Q8NHU2-5]
    uc010gcw.2. human. [Q8NHU2-3]

    Polymorphism databases

    DMDMi116241319.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK057364 mRNA. Translation: BAB71452.1 .
    AL117439 mRNA. Translation: CAB55925.1 .
    AL121721
    , AL035454 , AL049648 , AL161658 Genomic DNA. Translation: CAI19156.1 .
    AL121721 , AL049648 Genomic DNA. Translation: CAI19157.1 .
    AL049648 , AL121721 Genomic DNA. Translation: CAI42254.1 .
    AL035454
    , AL049648 , AL121721 , AL161658 Genomic DNA. Translation: CAI42114.1 . Sequence problems.
    AL049648
    , AL035454 , AL121721 , AL161658 Genomic DNA. Translation: CAI42250.1 .
    AL161658
    , AL035454 , AL049648 , AL121721 Genomic DNA. Translation: CAI40813.1 .
    BC028708 mRNA. Translation: AAH28708.2 .
    BC031674 mRNA. Translation: AAH31674.1 .
    CCDSi CCDS33447.1. [Q8NHU2-1 ]
    CCDS54452.1. [Q8NHU2-3 ]
    RefSeqi NP_001161288.1. NM_001167816.1. [Q8NHU2-3 ]
    NP_056400.3. NM_015585.3. [Q8NHU2-1 ]
    XP_005260746.1. XM_005260689.2. [Q8NHU2-1 ]
    UniGenei Hs.729168.

    3D structure databases

    ProteinModelPortali Q8NHU2.
    SMRi Q8NHU2. Positions 837-867.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117532. 1 interaction.
    IntActi Q8NHU2. 1 interaction.
    MINTi MINT-7970708.

    PTM databases

    PhosphoSitei Q8NHU2.

    Polymorphism databases

    DMDMi 116241319.

    Proteomic databases

    MaxQBi Q8NHU2.
    PaxDbi Q8NHU2.
    PRIDEi Q8NHU2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000245957 ; ENSP00000245957 ; ENSG00000089101 . [Q8NHU2-1 ]
    ENST00000377293 ; ENSP00000366508 ; ENSG00000089101 . [Q8NHU2-5 ]
    ENST00000377306 ; ENSP00000366521 ; ENSG00000089101 . [Q8NHU2-3 ]
    ENST00000377308 ; ENSP00000366523 ; ENSG00000089101 . [Q8NHU2-6 ]
    ENST00000389656 ; ENSP00000374307 ; ENSG00000089101 . [Q8NHU2-5 ]
    ENST00000451767 ; ENSP00000414537 ; ENSG00000089101 . [Q8NHU2-3 ]
    GeneIDi 26074.
    KEGGi hsa:26074.
    UCSCi uc002wru.3. human. [Q8NHU2-1 ]
    uc002wrv.3. human. [Q8NHU2-5 ]
    uc010gcw.2. human. [Q8NHU2-3 ]

    Organism-specific databases

    CTDi 26074.
    GeneCardsi GC20P020033.
    H-InvDB HIX0015679.
    HGNCi HGNC:15872. C20orf26.
    HPAi HPA009079.
    neXtProti NX_Q8NHU2.
    PharmGKBi PA25741.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG72837.
    HOVERGENi HBG081363.
    OMAi PQLHVRK.
    OrthoDBi EOG7KSX7P.
    PhylomeDBi Q8NHU2.
    TreeFami TF323897.

    Miscellaneous databases

    ChiTaRSi C20orf26. human.
    GenomeRNAii 26074.
    NextBioi 47987.

    Gene expression databases

    ArrayExpressi Q8NHU2.
    Bgeei Q8NHU2.
    CleanExi HS_C20orf26.
    Genevestigatori Q8NHU2.

    Family and domain databases

    Gene3Di 3.40.630.30. 1 hit.
    InterProi IPR016181. Acyl_CoA_acyltransferase.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
      Tissue: Testis.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Testis.
    3. "The DNA sequence and comparative analysis of human chromosome 20."
      Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
      , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
      Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), VARIANTS ARG-74 AND ILE-369.
      Tissue: Brain and Testis.
    5. Cited for: NUCLEOTIDE SEQUENCE OF 287-409 (ISOFORM 4).
    6. Cited for: VARIANT PRO-790.

    Entry informationi

    Entry nameiCT026_HUMAN
    AccessioniPrimary (citable) accession number: Q8NHU2
    Secondary accession number(s): A6NHA1
    , Q5JXV4, Q5TE18, Q8N5R9, Q96M59, Q9BQL2, Q9H127, Q9H128, Q9NQH4, Q9UFV8, Q9Y4V7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 28, 2003
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 95 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 20
      Human chromosome 20: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations

    External Data

    Dasty 3