Q8NHU2 (CT026_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 83.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uncharacterized protein C20orf26 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1237 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence caution | The sequence CAI42114.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q8NHU2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 3 (identifier: Q8NHU2-3) The sequence of this isoform differs from the canonical sequence as follows: 463-470: SINIRFAT → NICLGRSS 471-1237: Missing. | ||||||
| Isoform 4 (identifier: Q8NHU2-4) The sequence of this isoform differs from the canonical sequence as follows: 343-402: Missing. | ||||||
| Isoform 5 (identifier: Q8NHU2-5) The sequence of this isoform differs from the canonical sequence as follows: 1-644: Missing. 835-844: GNIIVYGNTI → DGGRASVLFC 845-1237: Missing. | ||||||
| Note: Created from a fragment entry and may await further characterization. | ||||||
| Isoform 6 (identifier: Q8NHU2-6) The sequence of this isoform differs from the canonical sequence as follows: 1-644: Missing. 933-964: MFFSFCEKNVDYETFKALNDACLVYDSRLVID → GAFFLGLTIICILPSLPFQLPWRYKWHSLIMV 965-1237: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1237 | 1237 | Uncharacterized protein C20orf26 | PRO_0000079417 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 644 | 644 | Missing in isoform 5 and isoform 6. | VSP_003802 | |||||
| Alternative sequence | 343 – 402 | 60 | Missing in isoform 4. | VSP_003798 | |||||
| Alternative sequence | 463 – 470 | 8 | SINIRFAT → NICLGRSS in isoform 3. | VSP_003799 | |||||
| Alternative sequence | 471 – 1237 | 767 | Missing in isoform 3. | VSP_003800 | |||||
| Alternative sequence | 835 – 844 | 10 | GNIIVYGNTI → DGGRASVLFC in isoform 5. | VSP_003803 | |||||
| Alternative sequence | 845 – 1237 | 393 | Missing in isoform 5. | VSP_003804 | |||||
| Alternative sequence | 933 – 964 | 32 | MFFSF…RLVID → GAFFLGLTIICILPSLPFQL PWRYKWHSLIMV in isoform 6. | VSP_013682 | |||||
| Alternative sequence | 965 – 1237 | 273 | Missing in isoform 6. | VSP_013683 | |||||
| Natural variant | 74 | 1 | P → R. Ref.4 Corresponds to variant rs17852602 [ dbSNP | Ensembl ]. | VAR_027981 | |||||
| Natural variant | 254 | 1 | H → R. Corresponds to variant rs6075614 [ dbSNP | Ensembl ]. | VAR_027982 | |||||
| Natural variant | 369 | 1 | V → I. Ref.4 Corresponds to variant rs6081901 [ dbSNP | Ensembl ]. | VAR_027983 | |||||
| Natural variant | 371 | 1 | P → L. Corresponds to variant rs6075628 [ dbSNP | Ensembl ]. | VAR_027984 | |||||
| Natural variant | 505 | 1 | D → E. Corresponds to variant rs7344530 [ dbSNP | Ensembl ]. | VAR_027985 | |||||
| Natural variant | 660 | 1 | P → L. Corresponds to variant rs6081930 [ dbSNP | Ensembl ]. | VAR_027986 | |||||
| Natural variant | 671 | 1 | V → I. Corresponds to variant rs6046740 [ dbSNP | Ensembl ]. | VAR_027987 | |||||
Experimental info | |||||||||
| Sequence conflict | 650 | 1 | N → S in AAH31674. Ref.4 | ||||||
| Isoform 6: | |||||||||
| Sequence conflict | 123 | 1 | L → P in BAB71452. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK057364 mRNA. Translation: BAB71452.1. AL117439 mRNA. Translation: CAB55925.1. AL121721 AL161658 Genomic DNA. Translation: CAI19156.1.AL121721, AL049648 Genomic DNA. Translation: CAI19157.1. AL049648, AL121721 Genomic DNA. Translation: CAI42254.1. AL035454 AL161658 Genomic DNA. Translation: CAI42114.1. Sequence problems.AL049648 AL161658 Genomic DNA. Translation: CAI42250.1.AL161658 AL121721 Genomic DNA. Translation: CAI40813.1.BC028708 mRNA. Translation: AAH28708.2. BC031674 mRNA. Translation: AAH31674.1. |
| IPI | IPI00169330. IPI00219969. IPI00219970. IPI00219971. IPI00555824. |
| RefSeq | NP_001161288.1. NM_001167816.1. NP_056400.3. NM_015585.3. |
| UniGene | Hs.729168. |
3D structure databases | |
| ProteinModelPortal | Q8NHU2. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8NHU2. |
Polymorphism databases | |
| DMDM | 116241319. |
Proteomic databases | |
| PaxDb | Q8NHU2. |
| PRIDE | Q8NHU2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000245957; ENSP00000245957; ENSG00000089101. ENST00000377293; ENSP00000366508; ENSG00000089101. ENST00000377306; ENSP00000366521; ENSG00000089101. ENST00000377308; ENSP00000366523; ENSG00000089101. ENST00000377309; ENSP00000366524; ENSG00000089101. ENST00000389656; ENSP00000374307; ENSG00000089101. ENST00000451767; ENSP00000414537; ENSG00000089101. |
| GeneID | 26074. |
| KEGG | hsa:26074. |
| UCSC | uc002wru.3. human. uc002wrv.3. human. uc010gcw.2. human. |
Organism-specific databases | |
| CTD | 26074. |
| GeneCards | GC20P020033. |
| H-InvDB | HIX0015679. |
| HGNC | HGNC:15872. C20orf26. |
| HPA | HPA009079. |
| neXtProt | NX_Q8NHU2. |
| PharmGKB | PA25741. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG72837. |
| HOVERGEN | HBG081363. |
| OMA | MFFSFCE. |
| OrthoDB | EOG43XV2W. |
Gene expression databases | |
| ArrayExpress | Q8NHU2. |
| Bgee | Q8NHU2. |
| CleanEx | HS_C20orf26. |
| Genevestigator | Q8NHU2. |
| GermOnline | ENSG00000089101. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.630.30. 1 hit. |
| InterPro | IPR016181. Acyl_CoA_acyltransferase. [Graphical view] |
| SUPFAM | SSF55729. Acyl_CoA_acyltransferase. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | C20orf26. human. |
| GenomeRNAi | 26074. |
| NextBio | 47987. |
Entry information
| Entry name | CT026_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NHU2 Secondary accession number(s): A6NHA1 Q9Y4V7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with
