SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NHU2

- CT026_HUMAN

UniProt

Q8NHU2 - CT026_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Uncharacterized protein C20orf26

Gene
C20orf26
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C20orf26
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 20

Organism-specific databases

HGNCiHGNC:15872. C20orf26.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25741.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12371237Uncharacterized protein C20orf26PRO_0000079417Add
BLAST

Proteomic databases

MaxQBiQ8NHU2.
PaxDbiQ8NHU2.
PRIDEiQ8NHU2.

PTM databases

PhosphoSiteiQ8NHU2.

Expressioni

Gene expression databases

ArrayExpressiQ8NHU2.
BgeeiQ8NHU2.
CleanExiHS_C20orf26.
GenevestigatoriQ8NHU2.

Organism-specific databases

HPAiHPA009079.

Interactioni

Protein-protein interaction databases

BioGridi117532. 1 interaction.
IntActiQ8NHU2. 1 interaction.
MINTiMINT-7970708.

Structurei

3D structure databases

ProteinModelPortaliQ8NHU2.
SMRiQ8NHU2. Positions 837-867.

Family & Domainsi

Phylogenomic databases

eggNOGiNOG72837.
HOVERGENiHBG081363.
OMAiPQLHVRK.
OrthoDBiEOG7KSX7P.
PhylomeDBiQ8NHU2.
TreeFamiTF323897.

Family and domain databases

Gene3Di3.40.630.30. 1 hit.
InterProiIPR016181. Acyl_CoA_acyltransferase.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: Q8NHU2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSVLTSPRGK VEVVHCRRTE SQDVYCIKSL IRKFTCKLFG KLNIIYLLEK     50
ANLAVTLCND KEEIMAQATF LDYPNWNVAK QDDWVSVFRE LDSDIPCTPL 100
NTLFMHLFVA VDEYSVGCCK EILRTVYKAV PELHFIFLIV PSYMSLGSTL 150
ITVFDQVGNI PCLTYEEDFA VHICHRHSHY PQLHVRKARV EDHDDLMPIF 200
MRYDTILKET YGEYFLAELI EAQDEENHAV VCEVEGTAVG FMSVCSRVNM 250
QLLHECFDLG PFHGLCFPHP DDVLESPQDL SVRRSQDAEL RSSSQGSQKI 300
VEELQEPVSP DTMENIQGNI AREAASEEAL TAVQSGNVSE PEDIEKLSDI 350
STGYAQYHHV SSRSLASLVL PEEPVHFRPI YRGASAAFCI QLFCIDEKYE 400
ARSLDFMNFV FSLFSDKNFC VISLPHLTPE FFLIQNFVKM VPFNTCTLEQ 450
DLYVFHRAGL LKSINIRFAT LLDTPGVENL VSTLMLNKSI LEDLDRYNKA 500
RKDPDGTLLQ AFVAEVAEQI VGIAVIRNEM DIEYIRSHYN IEDFIYFSHH 550
QREEHGHMHH FALNPIFRHY TKFFLKEILR LGFKSCLYYR VYPKSREGKF 600
QNPYAHSLTS ALHYLVPVRP RRQIVYPLEK LGINAPSKAV SKDPMSYALN 650
HTNRKLTLEP KITVNAKIIV VGASSVGISF LETLVFCSHM KFNNLTLIST 700
HGLPGKKLLD TEQRKFLASD HCFNDKDYAL MSLCSWVNVV VGRMTGIDRA 750
AKHVVLSTDE IVPYDHLILC TGQQYQVPCP TEADISQHLT NREVPNSSQR 800
RYTGKVPCNH FTLNEEEDCF KALIWIRNNS ITTEGNIIVY GNTIDTYTTV 850
ETLLNLGVSG SRIHLVQPPP ASTITCINNY SVESAVADAL GAAGVTMYRD 900
AILAQWNDGL HPDPIYSASF TTPTKPFRLQ CSMFFSFCEK NVDYETFKAL 950
NDACLVYDSR LVIDTNFHTN DIAIRAAGSL TKFSNRYYSN EWTHSNFSSK 1000
EIGFQLAAAM LHLFDPTLEP VTEPPANLDR LIPMYKGAKI QGGILPGSYH 1050
YLHIAKPAIP TPLEVQMAQP NYGLELVTGS AKNGTYFRIH INKYKMVETI 1100
TCLSREPFPA SNYIRLFGQH EQLLNNLCAR YDENLITDLY SYFTEPWCLA 1150
LFHDRFIDLR KELRQILASK EEEDLPSIEQ LAHQIEDEEI NPTEKPRQYL 1200
KRVFEESIYK TLVERSTLDY LHYNRYHLPM YAWPGIV 1237
Length:1,237
Mass (Da):141,349
Last modified:October 17, 2006 - v3
Checksum:iF10E9802BFAC8956
GO
Isoform 3 (identifier: Q8NHU2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     463-470: SINIRFAT → NICLGRSS
     471-1237: Missing.

Show »
Length:470
Mass (Da):53,551
Checksum:i0DFF08A0D16B1034
GO
Isoform 4 (identifier: Q8NHU2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     343-402: Missing.

Show »
Length:1,177
Mass (Da):134,537
Checksum:iE5459E025C959DAE
GO
Isoform 5 (identifier: Q8NHU2-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-644: Missing.
     835-844: GNIIVYGNTI → DGGRASVLFC
     845-1237: Missing.

Note: Created from a fragment entry and may await further characterization.

Show »
Length:200
Mass (Da):22,433
Checksum:i4C38A05D39B1979C
GO
Isoform 6 (identifier: Q8NHU2-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-644: Missing.
     933-964: MFFSFCEKNVDYETFKALNDACLVYDSRLVID → GAFFLGLTIICILPSLPFQLPWRYKWHSLIMV
     965-1237: Missing.

Show »
Length:320
Mass (Da):35,610
Checksum:iCF8979E3AE27B7B5
GO

Sequence cautioni

The sequence CAI42114.1 differs from that shown. Reason: Erroneous gene model prediction.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti74 – 741P → R.1 Publication
Corresponds to variant rs17852602 [ dbSNP | Ensembl ].
VAR_027981
Natural varianti254 – 2541H → R.
Corresponds to variant rs6075614 [ dbSNP | Ensembl ].
VAR_027982
Natural varianti369 – 3691V → I.1 Publication
Corresponds to variant rs6081901 [ dbSNP | Ensembl ].
VAR_027983
Natural varianti371 – 3711P → L.
Corresponds to variant rs6075628 [ dbSNP | Ensembl ].
VAR_027984
Natural varianti505 – 5051D → E.
Corresponds to variant rs7344530 [ dbSNP | Ensembl ].
VAR_027985
Natural varianti660 – 6601P → L.
Corresponds to variant rs6081930 [ dbSNP | Ensembl ].
VAR_027986
Natural varianti671 – 6711V → I.
Corresponds to variant rs6046740 [ dbSNP | Ensembl ].
VAR_027987
Natural varianti790 – 7901T → P.1 Publication
VAR_069396

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 644644Missing in isoform 5 and isoform 6. VSP_003802Add
BLAST
Alternative sequencei343 – 40260Missing in isoform 4. VSP_003798Add
BLAST
Alternative sequencei463 – 4708SINIRFAT → NICLGRSS in isoform 3. VSP_003799
Alternative sequencei471 – 1237767Missing in isoform 3. VSP_003800Add
BLAST
Alternative sequencei835 – 84410GNIIVYGNTI → DGGRASVLFC in isoform 5. VSP_003803
Alternative sequencei845 – 1237393Missing in isoform 5. VSP_003804Add
BLAST
Alternative sequencei933 – 96432MFFSF…RLVID → GAFFLGLTIICILPSLPFQL PWRYKWHSLIMV in isoform 6. VSP_013682Add
BLAST
Alternative sequencei965 – 1237273Missing in isoform 6. VSP_013683Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti650 – 6501N → S in AAH31674. 1 Publication
Isoform 6 (identifier: Q8NHU2-6)
Sequence conflicti123 – 1231L → P in BAB71452. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK057364 mRNA. Translation: BAB71452.1.
AL117439 mRNA. Translation: CAB55925.1.
AL121721
, AL035454, AL049648, AL161658 Genomic DNA. Translation: CAI19156.1.
AL121721, AL049648 Genomic DNA. Translation: CAI19157.1.
AL049648, AL121721 Genomic DNA. Translation: CAI42254.1.
AL035454
, AL049648, AL121721, AL161658 Genomic DNA. Translation: CAI42114.1. Sequence problems.
AL049648
, AL035454, AL121721, AL161658 Genomic DNA. Translation: CAI42250.1.
AL161658
, AL035454, AL049648, AL121721 Genomic DNA. Translation: CAI40813.1.
BC028708 mRNA. Translation: AAH28708.2.
BC031674 mRNA. Translation: AAH31674.1.
CCDSiCCDS33447.1. [Q8NHU2-1]
CCDS54452.1. [Q8NHU2-3]
RefSeqiNP_001161288.1. NM_001167816.1. [Q8NHU2-3]
NP_056400.3. NM_015585.3. [Q8NHU2-1]
XP_005260746.1. XM_005260689.2. [Q8NHU2-1]
UniGeneiHs.729168.

Genome annotation databases

EnsembliENST00000245957; ENSP00000245957; ENSG00000089101. [Q8NHU2-1]
ENST00000377293; ENSP00000366508; ENSG00000089101. [Q8NHU2-5]
ENST00000377306; ENSP00000366521; ENSG00000089101. [Q8NHU2-3]
ENST00000377308; ENSP00000366523; ENSG00000089101. [Q8NHU2-6]
ENST00000377309; ENSP00000366524; ENSG00000089101. [Q8NHU2-6]
ENST00000389656; ENSP00000374307; ENSG00000089101. [Q8NHU2-5]
ENST00000451767; ENSP00000414537; ENSG00000089101. [Q8NHU2-3]
GeneIDi26074.
KEGGihsa:26074.
UCSCiuc002wru.3. human. [Q8NHU2-1]
uc002wrv.3. human. [Q8NHU2-5]
uc010gcw.2. human. [Q8NHU2-3]

Polymorphism databases

DMDMi116241319.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK057364 mRNA. Translation: BAB71452.1 .
AL117439 mRNA. Translation: CAB55925.1 .
AL121721
, AL035454 , AL049648 , AL161658 Genomic DNA. Translation: CAI19156.1 .
AL121721 , AL049648 Genomic DNA. Translation: CAI19157.1 .
AL049648 , AL121721 Genomic DNA. Translation: CAI42254.1 .
AL035454
, AL049648 , AL121721 , AL161658 Genomic DNA. Translation: CAI42114.1 . Sequence problems.
AL049648
, AL035454 , AL121721 , AL161658 Genomic DNA. Translation: CAI42250.1 .
AL161658
, AL035454 , AL049648 , AL121721 Genomic DNA. Translation: CAI40813.1 .
BC028708 mRNA. Translation: AAH28708.2 .
BC031674 mRNA. Translation: AAH31674.1 .
CCDSi CCDS33447.1. [Q8NHU2-1 ]
CCDS54452.1. [Q8NHU2-3 ]
RefSeqi NP_001161288.1. NM_001167816.1. [Q8NHU2-3 ]
NP_056400.3. NM_015585.3. [Q8NHU2-1 ]
XP_005260746.1. XM_005260689.2. [Q8NHU2-1 ]
UniGenei Hs.729168.

3D structure databases

ProteinModelPortali Q8NHU2.
SMRi Q8NHU2. Positions 837-867.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117532. 1 interaction.
IntActi Q8NHU2. 1 interaction.
MINTi MINT-7970708.

PTM databases

PhosphoSitei Q8NHU2.

Polymorphism databases

DMDMi 116241319.

Proteomic databases

MaxQBi Q8NHU2.
PaxDbi Q8NHU2.
PRIDEi Q8NHU2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000245957 ; ENSP00000245957 ; ENSG00000089101 . [Q8NHU2-1 ]
ENST00000377293 ; ENSP00000366508 ; ENSG00000089101 . [Q8NHU2-5 ]
ENST00000377306 ; ENSP00000366521 ; ENSG00000089101 . [Q8NHU2-3 ]
ENST00000377308 ; ENSP00000366523 ; ENSG00000089101 . [Q8NHU2-6 ]
ENST00000377309 ; ENSP00000366524 ; ENSG00000089101 . [Q8NHU2-6 ]
ENST00000389656 ; ENSP00000374307 ; ENSG00000089101 . [Q8NHU2-5 ]
ENST00000451767 ; ENSP00000414537 ; ENSG00000089101 . [Q8NHU2-3 ]
GeneIDi 26074.
KEGGi hsa:26074.
UCSCi uc002wru.3. human. [Q8NHU2-1 ]
uc002wrv.3. human. [Q8NHU2-5 ]
uc010gcw.2. human. [Q8NHU2-3 ]

Organism-specific databases

CTDi 26074.
GeneCardsi GC20P020033.
H-InvDB HIX0015679.
HGNCi HGNC:15872. C20orf26.
HPAi HPA009079.
neXtProti NX_Q8NHU2.
PharmGKBi PA25741.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG72837.
HOVERGENi HBG081363.
OMAi PQLHVRK.
OrthoDBi EOG7KSX7P.
PhylomeDBi Q8NHU2.
TreeFami TF323897.

Miscellaneous databases

ChiTaRSi C20orf26. human.
GenomeRNAii 26074.
NextBioi 47987.

Gene expression databases

ArrayExpressi Q8NHU2.
Bgeei Q8NHU2.
CleanExi HS_C20orf26.
Genevestigatori Q8NHU2.

Family and domain databases

Gene3Di 3.40.630.30. 1 hit.
InterProi IPR016181. Acyl_CoA_acyltransferase.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  3. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5), VARIANTS ARG-74 AND ILE-369.
    Tissue: Brain and Testis.
  5. Cited for: NUCLEOTIDE SEQUENCE OF 287-409 (ISOFORM 4).
  6. Cited for: VARIANT PRO-790.

Entry informationi

Entry nameiCT026_HUMAN
AccessioniPrimary (citable) accession number: Q8NHU2
Secondary accession number(s): A6NHA1
, Q5JXV4, Q5TE18, Q8N5R9, Q96M59, Q9BQL2, Q9H127, Q9H128, Q9NQH4, Q9UFV8, Q9Y4V7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: October 17, 2006
Last modified: July 9, 2014
This is version 94 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

External Data

Dasty 3

Similar proteinsi