Q8NHQ8 (RASF8_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ras association domain-containing protein 8 Alternative name(s): Carcinoma-associated protein HOJ-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 419 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Tissue specificity | Widely expressed as a 6.2 kb transcript. A 2.2 kb alternatively spliced transcript is expressed exclusively in testis. Ref.7 |
| Involvement in disease | Note=A chromosomal aberration involving RASSF8 is found in a complex type of synpolydactyly referred to as 3/3-prime/4 synpolydactyly associated with metacarpal and metatarsal synostoses. Reciprocal translocation t(12;22)(p11.2;q13.3) with C12orf2. |
| Sequence similarities | Contains 1 Ras-associating domain. |
| Sequence caution | The sequence AAC95425.1 differs from that shown. Reason: Frameshift at position 108. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | signal transduction Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NHQ8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NHQ8-2) The sequence of this isoform differs from the canonical sequence as follows: 380-419: EAPFQSGSLKRPGSSRQLPSNLRILQNPISSGFNPEGIYV → GIIILSDKQECKD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 419 | 419 | Ras association domain-containing protein 8 | PRO_0000089840 | |||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||
| Domain | 1 – 82 | 82 | Ras-associating | ||||||||||||||||||||||||||||
| Compositional bias | 181 – 290 | 110 | Glu-rich | ||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||
| Modified residue | 83 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||
| Modified residue | 85 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||
| Modified residue | 105 | 1 | Phosphoserine Ref.9 | ||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||
| Alternative sequence | 380 – 419 | 40 | EAPFQ…EGIYV → GIIILSDKQECKD in isoform 2. | VSP_014248 | |||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||
| Sequence conflict | 15 | 1 | C → Y in BAC98838. Ref.1 | ||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||
| Beta strand | 5 – 7 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 10 – 12 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 15 – 17 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 19 – 21 | 3 | |||||||||||||||||||||||||||||
| Helix | 23 – 34 | 12 | |||||||||||||||||||||||||||||
| Beta strand | 38 – 46 | 9 | |||||||||||||||||||||||||||||
| Beta strand | 49 – 52 | 4 | |||||||||||||||||||||||||||||
| Beta strand | 55 – 57 | 3 | |||||||||||||||||||||||||||||
| Helix | 59 – 64 | 6 | |||||||||||||||||||||||||||||
| Helix | 67 – 69 | 3 | |||||||||||||||||||||||||||||
| Beta strand | 74 – 81 | 8 | |||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Search for genes at a human lung adenocarcinoma susceptibility locus, possibly syntenic to the mouse Pas1 locus." Yanagitani N., Kohno T., Yokota J. Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Population-based association study on two candidate lung adenocarcinoma modifier genes flanking the D12S1034 locus." Falvella F.S., Manenti G., Spinola M., Pignatiello C., Ravagnani F., Conti B., Pastorino U., Dragani T.A. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Lung. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Hippocampus. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [6] | "HoJ-1 carcinoma associated gene." Hoon D.S.B., Yuzuki D. Submitted (DEC-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-185. Tissue: Testis. |
| [7] | "Physical map of a 1.5 mb region on 12p11.2 harbouring a synpolydactyly associated chromosomal breakpoint." Debeer P., Schoenmakers E.F.P.M., Thoelen R., Holvoet M., Kuittinen T., Fabry G., Fryns J.-P., Goodman F.R., Van de Ven W.J.M. Eur. J. Hum. Genet. 8:561-570(2000) [PubMed: 10951517] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [8] | "The fibulin-1 gene (FBLN1) is disrupted in a t(12;22) associated with a complex type of synpolydactyly." Debeer P., Schoenmakers E.F.P.M., Twal W.O., Argraves W.S., De Smet L., Fryns J.-P., Van De Ven W.J.M. J. Med. Genet. 39:98-104(2002) [PubMed: 11836357] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-105, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Solution structure of N-terminal domain of chromosome 12 open reading frame 2." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 1-83. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB093206 mRNA. Translation: BAC98838.1. AY665468 mRNA. Translation: AAV54603.1. AK290055 mRNA. Translation: BAF82744.1. CH471094 Genomic DNA. Translation: EAW96523.1. BC030021 mRNA. Translation: AAH30021.1. U82396 mRNA. Translation: AAC95425.1. Frameshift. | ||||||||||||
| IPI | IPI00169294. IPI00607715. | ||||||||||||
| RefSeq | NP_001158218.1. NM_001164746.1. NP_001158219.1. NM_001164747.1. NP_001158220.1. NM_001164748.1. NP_009142.2. NM_007211.4. | ||||||||||||
| UniGene | Hs.696433. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q8NHQ8. | ||||||||||||
| SMR | Q8NHQ8. Positions 1-83. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q8NHQ8. 4 interactions. | ||||||||||||
| MINT | MINT-1445675. | ||||||||||||
| STRING | Q8NHQ8. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q8NHQ8. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 68068057. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q8NHQ8. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000405154; ENSP00000384491; ENSG00000123094. | ||||||||||||
| GeneID | 11228. | ||||||||||||
| KEGG | hsa:11228. | ||||||||||||
| UCSC | uc001rgx.2. human. uc001rgz.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 11228. | ||||||||||||
| GeneCards | GC12P026111. | ||||||||||||
| HGNC | HGNC:13232. RASSF8. | ||||||||||||
| HPA | HPA038164. | ||||||||||||
| MIM | 608180. phenotype. 608231. gene. | ||||||||||||
| neXtProt | NX_Q8NHQ8. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG05563. | ||||||||||||
| GeneTree | ENSGT00530000063648. | ||||||||||||
| HOGENOM | HBG445782. | ||||||||||||
| HOVERGEN | HBG050971. | ||||||||||||
| InParanoid | Q8NHQ8. | ||||||||||||
| OMA | TECESKL. | ||||||||||||
| PhylomeDB | Q8NHQ8. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q8NHQ8. | ||||||||||||
| Bgee | Q8NHQ8. | ||||||||||||
| CleanEx | HS_RASSF8. | ||||||||||||
| Genevestigator | Q8NHQ8. | ||||||||||||
| GermOnline | ENSG00000123094. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000159. Ras-assoc. [Graphical view] | ||||||||||||
| KO | K09856. | ||||||||||||
| Pfam | PF00788. RA. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00314. RA. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50200. RA. 1 hit. PS51070. SHD. False negative. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 42734. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RASF8_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NHQ8 Secondary accession number(s): A8K1Z0 Q76KB6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with