Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NHH9

- ATLA2_HUMAN

UniProt

Q8NHH9 - ATLA2_HUMAN

Protein

Atlastin-2

Gene

ATL2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 89 (01 Oct 2014)
      Sequence version 2 (15 May 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GTPase tethering membranes through formation of trans-homooligomers and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis.2 Publications

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi101 – 1088GTPBy similarity
    Nucleotide bindingi145 – 1473GTPBy similarity
    Nucleotide bindingi244 – 2452GTPBy similarity
    Nucleotide bindingi303 – 3064GTPBy similarity

    GO - Molecular functioni

    1. GTPase activity Source: UniProtKB
    2. GTP binding Source: UniProtKB-KW
    3. identical protein binding Source: UniProtKB
    4. protein binding Source: UniProtKB

    GO - Biological processi

    1. endoplasmic reticulum organization Source: UniProtKB
    2. Golgi organization Source: UniProtKB
    3. GTP catabolic process Source: GOC
    4. protein homooligomerization Source: UniProtKB

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    GTP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Atlastin-2 (EC:3.6.5.-)
    Alternative name(s):
    ADP-ribosylation factor-like protein 6-interacting protein 2
    Short name:
    ARL-6-interacting protein 2
    Short name:
    Aip-2
    Gene namesi
    Name:ATL2
    Synonyms:ARL6IP2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:24047. ATL2.

    Subcellular locationi

    Endoplasmic reticulum membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. endoplasmic reticulum Source: UniProtKB
    2. endoplasmic reticulum membrane Source: UniProtKB-SubCell
    3. integral component of membrane Source: UniProtKB
    4. membrane Source: UniProtKB

    Keywords - Cellular componenti

    Endoplasmic reticulum, Membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi107 – 1071K → A: Alters endoplasmic reticulum morphology. 1 Publication
    Mutagenesisi244 – 2441R → Q: Alters endoplasmic reticulum morphogenesis. 1 Publication

    Organism-specific databases

    PharmGKBiPA164716322.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 583583Atlastin-2PRO_0000287105Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei24 – 241Phosphoserine2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8NHH9.
    PaxDbiQ8NHH9.
    PRIDEiQ8NHH9.

    PTM databases

    PhosphoSiteiQ8NHH9.

    Expressioni

    Tissue specificityi

    Expressed in peripheral tissues (at protein level).1 Publication

    Gene expression databases

    ArrayExpressiQ8NHH9.
    BgeeiQ8NHH9.
    CleanExiHS_ATL2.
    GenevestigatoriQ8NHH9.

    Organism-specific databases

    HPAiHPA029108.

    Interactioni

    Subunit structurei

    Interacts with REEP5 and RTN3.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Reep5Q608702EBI-2410430,EBI-2410304From a different organism.
    Rtn3Q9ES97-32EBI-2410430,EBI-1487798From a different organism.

    Protein-protein interaction databases

    BioGridi122115. 3 interactions.
    IntActiQ8NHH9. 4 interactions.
    MINTiMINT-3295758.
    STRINGi9606.ENSP00000368237.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NHH9.
    SMRiQ8NHH9. Positions 57-469.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 476476Cytoplasmic1 PublicationAdd
    BLAST
    Topological domaini498 – 4992LumenalSequence Analysis
    Topological domaini521 – 58363Cytoplasmic1 PublicationAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei477 – 49721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei500 – 52021HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini91 – 336246GB1/RHD3-type GAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili256 – 28429Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Keywords - Domaini

    Coiled coil, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG325148.
    HOGENOMiHOG000234332.
    HOVERGENiHBG062891.
    InParanoidiQ8NHH9.
    KOiK17339.
    OMAiWRENELY.
    OrthoDBiEOG7H4DTH.
    PhylomeDBiQ8NHH9.
    TreeFamiTF105251.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR003191. Guanylate-bd_C.
    IPR015894. Guanylate-bd_N.
    IPR027417. P-loop_NTPase.
    [Graphical view]
    PfamiPF02263. GBP. 1 hit.
    PF02841. GBP_C. 1 hit.
    [Graphical view]
    SUPFAMiSSF48340. SSF48340. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEiPS51715. G_GB1_RHD3. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NHH9-1) [UniParc]FASTAAdd to Basket

    Also known as: AT2b

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAEGDEAARG QQPHQGLWRR RRTSDPSAAV NHVSSTTSLG ENYEDDDLVN    50
    SDEVMKKPCP VQIVLAHEDD HNFELDEEAL EQILLQEHIR DLNIVVVSVA 100
    GAFRKGKSFL LDFMLRYMYN KDSQSWIGGN NEPLTGFTWR GGCERETTGI 150
    QVWNEVFVID RPNGTKVAVL LMDTQGAFDS QSTIKDCATV FALSTMTSSV 200
    QVYNLSQNIQ EDDLQHLQLF TEYGRLAMEE IYQKPFQTLM FLIRDWSYPY 250
    EHSYGLEGGK QFLEKRLQVK QNQHEELQNV RKHIHNCFSN LGCFLLPHPG 300
    LKVATNPSFD GRLKDIDEDF KRELRNLVPL LLAPENLVEK EISGSKVTCR 350
    DLVEYFKAYI KIYQGEELPH PKSMLQATAE ANNLAAVAGA RDTYCKSMEQ 400
    VCGGDKPYIA PSDLERKHLD LKEVAIKQFR SVKKMGGDEF CRRYQDQLEA 450
    EIEETYANFI KHNDGKNIFY AARTPATLFA VMFAMYIISG LTGFIGLNSI 500
    AVLCNLVMGL ALIFLCTWAY VKYSGEFREI GTVIDQIAET LWEQVLKPLG 550
    DNLMEENIRQ SVTNSIKAGL TDQVSHHARL KTD 583
    Length:583
    Mass (Da):66,229
    Last modified:May 15, 2007 - v2
    Checksum:i885738C43996DEBF
    GO
    Isoform 2 (identifier: Q8NHH9-2) [UniParc]FASTAAdd to Basket

    Also known as: AT2a

    The sequence of this isoform differs from the canonical sequence as follows:
         546-583: LKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD → FSKLFEVTRRRMVHRALSSAQRQRLSSNNNKKKN

    Show »
    Length:579
    Mass (Da):66,087
    Checksum:i8C9D170C429AAA71
    GO
    Isoform 3 (identifier: Q8NHH9-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-171: Missing.

    Show »
    Length:412
    Mass (Da):46,918
    Checksum:iBA8D07DFDED793AF
    GO
    Isoform 4 (identifier: Q8NHH9-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSL → MVLKKGIKFFQRLINSKSLRF
         545-583: VLKPLGDNLM...VSHHARLKTD → RSPRKVFSKL...LSSNNNKKKN

    Show »
    Length:566
    Mass (Da):65,004
    Checksum:i6D82F46C7FCB8490
    GO
    Isoform 5 (identifier: Q8NHH9-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSL → MVLKKGIKFFQRLINSKSLRF

    Note: No experimental confirmation available.

    Show »
    Length:565
    Mass (Da):64,522
    Checksum:i9E1671FFF406376A
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti509 – 5091G → E in BAB15598. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti18 – 181W → R.1 Publication
    Corresponds to variant rs3731847 [ dbSNP | Ensembl ].
    VAR_032265
    Natural varianti272 – 2721N → S.
    Corresponds to variant rs34873284 [ dbSNP | Ensembl ].
    VAR_032266
    Natural varianti420 – 4201D → H.
    Corresponds to variant rs7582826 [ dbSNP | Ensembl ].
    VAR_032267

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 171171Missing in isoform 3. 1 PublicationVSP_025309Add
    BLAST
    Alternative sequencei1 – 3939MAEGD…STTSL → MVLKKGIKFFQRLINSKSLR F in isoform 4 and isoform 5. 1 PublicationVSP_041604Add
    BLAST
    Alternative sequencei545 – 58339VLKPL…RLKTD → RSPRKVFSKLFEVTRRRMVH RALSSAQRQRLSSNNNKKKN in isoform 4. 1 PublicationVSP_041605Add
    BLAST
    Alternative sequencei546 – 58338LKPLG…RLKTD → FSKLFEVTRRRMVHRALSSA QRQRLSSNNNKKKN in isoform 2. 1 PublicationVSP_025310Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF449187
    , AF449176, AF449177, AF449178, AF449179, AF449180, AF449181, AF449182, AF449183, AF449184, AF449185, AF449186 Genomic DNA. Translation: AAM97341.1.
    AF449187
    , AF449176, AF449177, AF449178, AF449179, AF449180, AF449181, AF449182, AF449183, AF449184, AF449185, AF449186 Genomic DNA. Translation: AAM97342.1.
    AK026946 mRNA. Translation: BAB15598.1.
    AK294049 mRNA. Translation: BAH11658.1.
    AK302621 mRNA. Translation: BAH13764.1.
    AK225190 mRNA. No translation available.
    AC016995 Genomic DNA. Translation: AAX88950.1.
    BC053508 mRNA. Translation: AAH53508.1.
    CCDSiCCDS1795.1. [Q8NHH9-2]
    CCDS46260.1. [Q8NHH9-1]
    RefSeqiNP_001129145.1. NM_001135673.1. [Q8NHH9-1]
    NP_071769.2. NM_022374.2. [Q8NHH9-2]
    XP_006712134.1. XM_006712071.1. [Q8NHH9-5]
    UniGeneiHs.727652.

    Genome annotation databases

    EnsembliENST00000378954; ENSP00000368237; ENSG00000119787. [Q8NHH9-1]
    ENST00000402054; ENSP00000384062; ENSG00000119787. [Q8NHH9-3]
    ENST00000419554; ENSP00000415336; ENSG00000119787. [Q8NHH9-2]
    ENST00000452935; ENSP00000390743; ENSG00000119787. [Q8NHH9-5]
    GeneIDi64225.
    KEGGihsa:64225.
    UCSCiuc002rqq.3. human. [Q8NHH9-1]
    uc002rqs.3. human. [Q8NHH9-2]
    uc010ynm.2. human. [Q8NHH9-4]

    Polymorphism databases

    DMDMi147742983.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF449187
    , AF449176 , AF449177 , AF449178 , AF449179 , AF449180 , AF449181 , AF449182 , AF449183 , AF449184 , AF449185 , AF449186 Genomic DNA. Translation: AAM97341.1 .
    AF449187
    , AF449176 , AF449177 , AF449178 , AF449179 , AF449180 , AF449181 , AF449182 , AF449183 , AF449184 , AF449185 , AF449186 Genomic DNA. Translation: AAM97342.1 .
    AK026946 mRNA. Translation: BAB15598.1 .
    AK294049 mRNA. Translation: BAH11658.1 .
    AK302621 mRNA. Translation: BAH13764.1 .
    AK225190 mRNA. No translation available.
    AC016995 Genomic DNA. Translation: AAX88950.1 .
    BC053508 mRNA. Translation: AAH53508.1 .
    CCDSi CCDS1795.1. [Q8NHH9-2 ]
    CCDS46260.1. [Q8NHH9-1 ]
    RefSeqi NP_001129145.1. NM_001135673.1. [Q8NHH9-1 ]
    NP_071769.2. NM_022374.2. [Q8NHH9-2 ]
    XP_006712134.1. XM_006712071.1. [Q8NHH9-5 ]
    UniGenei Hs.727652.

    3D structure databases

    ProteinModelPortali Q8NHH9.
    SMRi Q8NHH9. Positions 57-469.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122115. 3 interactions.
    IntActi Q8NHH9. 4 interactions.
    MINTi MINT-3295758.
    STRINGi 9606.ENSP00000368237.

    PTM databases

    PhosphoSitei Q8NHH9.

    Polymorphism databases

    DMDMi 147742983.

    Proteomic databases

    MaxQBi Q8NHH9.
    PaxDbi Q8NHH9.
    PRIDEi Q8NHH9.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000378954 ; ENSP00000368237 ; ENSG00000119787 . [Q8NHH9-1 ]
    ENST00000402054 ; ENSP00000384062 ; ENSG00000119787 . [Q8NHH9-3 ]
    ENST00000419554 ; ENSP00000415336 ; ENSG00000119787 . [Q8NHH9-2 ]
    ENST00000452935 ; ENSP00000390743 ; ENSG00000119787 . [Q8NHH9-5 ]
    GeneIDi 64225.
    KEGGi hsa:64225.
    UCSCi uc002rqq.3. human. [Q8NHH9-1 ]
    uc002rqs.3. human. [Q8NHH9-2 ]
    uc010ynm.2. human. [Q8NHH9-4 ]

    Organism-specific databases

    CTDi 64225.
    GeneCardsi GC02M038522.
    HGNCi HGNC:24047. ATL2.
    HPAi HPA029108.
    MIMi 609368. gene.
    neXtProti NX_Q8NHH9.
    PharmGKBi PA164716322.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG325148.
    HOGENOMi HOG000234332.
    HOVERGENi HBG062891.
    InParanoidi Q8NHH9.
    KOi K17339.
    OMAi WRENELY.
    OrthoDBi EOG7H4DTH.
    PhylomeDBi Q8NHH9.
    TreeFami TF105251.

    Miscellaneous databases

    GenomeRNAii 64225.
    NextBioi 35480339.
    PROi Q8NHH9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8NHH9.
    Bgeei Q8NHH9.
    CleanExi HS_ATL2.
    Genevestigatori Q8NHH9.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR003191. Guanylate-bd_C.
    IPR015894. Guanylate-bd_N.
    IPR027417. P-loop_NTPase.
    [Graphical view ]
    Pfami PF02263. GBP. 1 hit.
    PF02841. GBP_C. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48340. SSF48340. 1 hit.
    SSF52540. SSF52540. 1 hit.
    PROSITEi PS51715. G_GB1_RHD3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Physical/genetic map of the 2p22-2p21 region on chromosome 2."
      Gorry M.C., Zhang Y., Marks J.J., Suppe B., Hart P.S., Cortelli J.R., Pallos D., Hart T.C.
      Submitted (NOV-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2), VARIANT ARG-18.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4 AND 5).
      Tissue: Cerebellum and Testis.
    3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon.
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Brain.
    6. "Cellular localization, oligomerization, and membrane association of the hereditary spastic paraplegia 3A (SPG3A) protein atlastin."
      Zhu P.-P., Patterson A., Lavoie B., Stadler J., Shoeb M., Patel R., Blackstone C.
      J. Biol. Chem. 278:49063-49071(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.
    7. "Atlastin GTPases are required for Golgi apparatus and ER morphogenesis."
      Rismanchi N., Soderblom C., Stadler J., Zhu P.-P., Blackstone C.
      Hum. Mol. Genet. 17:1591-1604(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TOPOLOGY, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-107 AND ARG-244, TISSUE SPECIFICITY.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-24, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "A class of dynamin-like GTPases involved in the generation of the tubular ER network."
      Hu J., Shibata Y., Zhu P.-P., Voss C., Rismanchi N., Prinz W.A., Rapoport T.A., Blackstone C.
      Cell 138:549-561(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH REEP5 AND RTN3.
    10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-24, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiATLA2_HUMAN
    AccessioniPrimary (citable) accession number: Q8NHH9
    Secondary accession number(s): B7Z1X2
    , B7Z7X8, Q4ZG30, Q7Z630, Q8NHH8, Q9H5M7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 15, 2007
    Last sequence update: May 15, 2007
    Last modified: October 1, 2014
    This is version 89 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3