SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NHH9

- ATLA2_HUMAN

UniProt

Q8NHH9 - ATLA2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Atlastin-2
Gene
ATL2, ARL6IP2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

GTPase tethering membranes through formation of trans-homooligomers and mediating homotypic fusion of endoplasmic reticulum membranes. Functions in endoplasmic reticulum tubular network biogenesis.2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi101 – 1088GTP By similarity
Nucleotide bindingi145 – 1473GTP By similarity
Nucleotide bindingi244 – 2452GTP By similarity
Nucleotide bindingi303 – 3064GTP By similarity

GO - Molecular functioni

  1. GTP binding Source: UniProtKB-KW
  2. GTPase activity Source: UniProtKB
  3. identical protein binding Source: UniProtKB
  4. protein binding Source: UniProtKB

GO - Biological processi

  1. GTP catabolic process Source: GOC
  2. Golgi organization Source: UniProtKB
  3. endoplasmic reticulum organization Source: UniProtKB
  4. protein homooligomerization Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Atlastin-2 (EC:3.6.5.-)
Alternative name(s):
ADP-ribosylation factor-like protein 6-interacting protein 2
Short name:
ARL-6-interacting protein 2
Short name:
Aip-2
Gene namesi
Name:ATL2
Synonyms:ARL6IP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:24047. ATL2.

Subcellular locationi

Endoplasmic reticulum membrane; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 476476Cytoplasmic1 Publication
Add
BLAST
Transmembranei477 – 49721Helical; Reviewed prediction
Add
BLAST
Topological domaini498 – 4992Lumenal Reviewed prediction
Transmembranei500 – 52021Helical; Reviewed prediction
Add
BLAST
Topological domaini521 – 58363Cytoplasmic1 Publication
Add
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB
  2. endoplasmic reticulum membrane Source: UniProtKB-SubCell
  3. integral component of membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi107 – 1071K → A: Alters endoplasmic reticulum morphology. 1 Publication
Mutagenesisi244 – 2441R → Q: Alters endoplasmic reticulum morphogenesis. 1 Publication

Organism-specific databases

PharmGKBiPA164716322.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 583583Atlastin-2
PRO_0000287105Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei24 – 241Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8NHH9.
PaxDbiQ8NHH9.
PRIDEiQ8NHH9.

PTM databases

PhosphoSiteiQ8NHH9.

Expressioni

Tissue specificityi

Expressed in peripheral tissues (at protein level).1 Publication

Gene expression databases

ArrayExpressiQ8NHH9.
BgeeiQ8NHH9.
CleanExiHS_ATL2.
GenevestigatoriQ8NHH9.

Organism-specific databases

HPAiHPA029108.

Interactioni

Subunit structurei

Interacts with REEP5 and RTN3.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
Reep5Q608702EBI-2410430,EBI-2410304From a different organism.
Rtn3Q9ES97-32EBI-2410430,EBI-1487798From a different organism.

Protein-protein interaction databases

BioGridi122115. 3 interactions.
IntActiQ8NHH9. 4 interactions.
MINTiMINT-3295758.
STRINGi9606.ENSP00000368237.

Structurei

3D structure databases

ProteinModelPortaliQ8NHH9.
SMRiQ8NHH9. Positions 57-469.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini91 – 336246GB1/RHD3-type G
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili256 – 28429 Reviewed prediction
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG325148.
HOGENOMiHOG000234332.
HOVERGENiHBG062891.
InParanoidiQ8NHH9.
KOiK17339.
OMAiWRENELY.
OrthoDBiEOG7H4DTH.
PhylomeDBiQ8NHH9.
TreeFamiTF105251.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR003191. Guanylate-bd_C.
IPR015894. Guanylate-bd_N.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF02263. GBP. 1 hit.
PF02841. GBP_C. 1 hit.
[Graphical view]
SUPFAMiSSF48340. SSF48340. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEiPS51715. G_GB1_RHD3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8NHH9-1) [UniParc]FASTAAdd to Basket

Also known as: AT2b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAEGDEAARG QQPHQGLWRR RRTSDPSAAV NHVSSTTSLG ENYEDDDLVN    50
SDEVMKKPCP VQIVLAHEDD HNFELDEEAL EQILLQEHIR DLNIVVVSVA 100
GAFRKGKSFL LDFMLRYMYN KDSQSWIGGN NEPLTGFTWR GGCERETTGI 150
QVWNEVFVID RPNGTKVAVL LMDTQGAFDS QSTIKDCATV FALSTMTSSV 200
QVYNLSQNIQ EDDLQHLQLF TEYGRLAMEE IYQKPFQTLM FLIRDWSYPY 250
EHSYGLEGGK QFLEKRLQVK QNQHEELQNV RKHIHNCFSN LGCFLLPHPG 300
LKVATNPSFD GRLKDIDEDF KRELRNLVPL LLAPENLVEK EISGSKVTCR 350
DLVEYFKAYI KIYQGEELPH PKSMLQATAE ANNLAAVAGA RDTYCKSMEQ 400
VCGGDKPYIA PSDLERKHLD LKEVAIKQFR SVKKMGGDEF CRRYQDQLEA 450
EIEETYANFI KHNDGKNIFY AARTPATLFA VMFAMYIISG LTGFIGLNSI 500
AVLCNLVMGL ALIFLCTWAY VKYSGEFREI GTVIDQIAET LWEQVLKPLG 550
DNLMEENIRQ SVTNSIKAGL TDQVSHHARL KTD 583
Length:583
Mass (Da):66,229
Last modified:May 15, 2007 - v2
Checksum:i885738C43996DEBF
GO
Isoform 2 (identifier: Q8NHH9-2) [UniParc]FASTAAdd to Basket

Also known as: AT2a

The sequence of this isoform differs from the canonical sequence as follows:
     546-583: LKPLGDNLMEENIRQSVTNSIKAGLTDQVSHHARLKTD → FSKLFEVTRRRMVHRALSSAQRQRLSSNNNKKKN

Show »
Length:579
Mass (Da):66,087
Checksum:i8C9D170C429AAA71
GO
Isoform 3 (identifier: Q8NHH9-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-171: Missing.

Show »
Length:412
Mass (Da):46,918
Checksum:iBA8D07DFDED793AF
GO
Isoform 4 (identifier: Q8NHH9-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSL → MVLKKGIKFFQRLINSKSLRF
     545-583: VLKPLGDNLM...VSHHARLKTD → RSPRKVFSKL...LSSNNNKKKN

Show »
Length:566
Mass (Da):65,004
Checksum:i6D82F46C7FCB8490
GO
Isoform 5 (identifier: Q8NHH9-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: MAEGDEAARGQQPHQGLWRRRRTSDPSAAVNHVSSTTSL → MVLKKGIKFFQRLINSKSLRF

Note: No experimental confirmation available.

Show »
Length:565
Mass (Da):64,522
Checksum:i9E1671FFF406376A
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti18 – 181W → R.1 Publication
Corresponds to variant rs3731847 [ dbSNP | Ensembl ].
VAR_032265
Natural varianti272 – 2721N → S.
Corresponds to variant rs34873284 [ dbSNP | Ensembl ].
VAR_032266
Natural varianti420 – 4201D → H.
Corresponds to variant rs7582826 [ dbSNP | Ensembl ].
VAR_032267

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 171171Missing in isoform 3.
VSP_025309Add
BLAST
Alternative sequencei1 – 3939MAEGD…STTSL → MVLKKGIKFFQRLINSKSLR F in isoform 4 and isoform 5.
VSP_041604Add
BLAST
Alternative sequencei545 – 58339VLKPL…RLKTD → RSPRKVFSKLFEVTRRRMVH RALSSAQRQRLSSNNNKKKN in isoform 4.
VSP_041605Add
BLAST
Alternative sequencei546 – 58338LKPLG…RLKTD → FSKLFEVTRRRMVHRALSSA QRQRLSSNNNKKKN in isoform 2.
VSP_025310Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti509 – 5091G → E in BAB15598. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF449187
, AF449176, AF449177, AF449178, AF449179, AF449180, AF449181, AF449182, AF449183, AF449184, AF449185, AF449186 Genomic DNA. Translation: AAM97341.1.
AF449187
, AF449176, AF449177, AF449178, AF449179, AF449180, AF449181, AF449182, AF449183, AF449184, AF449185, AF449186 Genomic DNA. Translation: AAM97342.1.
AK026946 mRNA. Translation: BAB15598.1.
AK294049 mRNA. Translation: BAH11658.1.
AK302621 mRNA. Translation: BAH13764.1.
AK225190 mRNA. No translation available.
AC016995 Genomic DNA. Translation: AAX88950.1.
BC053508 mRNA. Translation: AAH53508.1.
CCDSiCCDS1795.1. [Q8NHH9-2]
CCDS46260.1. [Q8NHH9-1]
RefSeqiNP_001129145.1. NM_001135673.1. [Q8NHH9-1]
NP_071769.2. NM_022374.2. [Q8NHH9-2]
XP_006712134.1. XM_006712071.1. [Q8NHH9-5]
UniGeneiHs.727652.

Genome annotation databases

EnsembliENST00000332337; ENSP00000333393; ENSG00000119787. [Q8NHH9-4]
ENST00000378954; ENSP00000368237; ENSG00000119787. [Q8NHH9-1]
ENST00000402054; ENSP00000384062; ENSG00000119787. [Q8NHH9-3]
ENST00000419554; ENSP00000415336; ENSG00000119787. [Q8NHH9-2]
ENST00000452935; ENSP00000390743; ENSG00000119787.
ENST00000539122; ENSP00000446192; ENSG00000119787. [Q8NHH9-3]
GeneIDi64225.
KEGGihsa:64225.
UCSCiuc002rqq.3. human. [Q8NHH9-1]
uc002rqs.3. human. [Q8NHH9-2]
uc010ynm.2. human. [Q8NHH9-4]

Polymorphism databases

DMDMi147742983.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF449187
, AF449176 , AF449177 , AF449178 , AF449179 , AF449180 , AF449181 , AF449182 , AF449183 , AF449184 , AF449185 , AF449186 Genomic DNA. Translation: AAM97341.1 .
AF449187
, AF449176 , AF449177 , AF449178 , AF449179 , AF449180 , AF449181 , AF449182 , AF449183 , AF449184 , AF449185 , AF449186 Genomic DNA. Translation: AAM97342.1 .
AK026946 mRNA. Translation: BAB15598.1 .
AK294049 mRNA. Translation: BAH11658.1 .
AK302621 mRNA. Translation: BAH13764.1 .
AK225190 mRNA. No translation available.
AC016995 Genomic DNA. Translation: AAX88950.1 .
BC053508 mRNA. Translation: AAH53508.1 .
CCDSi CCDS1795.1. [Q8NHH9-2 ]
CCDS46260.1. [Q8NHH9-1 ]
RefSeqi NP_001129145.1. NM_001135673.1. [Q8NHH9-1 ]
NP_071769.2. NM_022374.2. [Q8NHH9-2 ]
XP_006712134.1. XM_006712071.1. [Q8NHH9-5 ]
UniGenei Hs.727652.

3D structure databases

ProteinModelPortali Q8NHH9.
SMRi Q8NHH9. Positions 57-469.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122115. 3 interactions.
IntActi Q8NHH9. 4 interactions.
MINTi MINT-3295758.
STRINGi 9606.ENSP00000368237.

PTM databases

PhosphoSitei Q8NHH9.

Polymorphism databases

DMDMi 147742983.

Proteomic databases

MaxQBi Q8NHH9.
PaxDbi Q8NHH9.
PRIDEi Q8NHH9.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000332337 ; ENSP00000333393 ; ENSG00000119787 . [Q8NHH9-4 ]
ENST00000378954 ; ENSP00000368237 ; ENSG00000119787 . [Q8NHH9-1 ]
ENST00000402054 ; ENSP00000384062 ; ENSG00000119787 . [Q8NHH9-3 ]
ENST00000419554 ; ENSP00000415336 ; ENSG00000119787 . [Q8NHH9-2 ]
ENST00000452935 ; ENSP00000390743 ; ENSG00000119787 .
ENST00000539122 ; ENSP00000446192 ; ENSG00000119787 . [Q8NHH9-3 ]
GeneIDi 64225.
KEGGi hsa:64225.
UCSCi uc002rqq.3. human. [Q8NHH9-1 ]
uc002rqs.3. human. [Q8NHH9-2 ]
uc010ynm.2. human. [Q8NHH9-4 ]

Organism-specific databases

CTDi 64225.
GeneCardsi GC02M038522.
HGNCi HGNC:24047. ATL2.
HPAi HPA029108.
MIMi 609368. gene.
neXtProti NX_Q8NHH9.
PharmGKBi PA164716322.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG325148.
HOGENOMi HOG000234332.
HOVERGENi HBG062891.
InParanoidi Q8NHH9.
KOi K17339.
OMAi WRENELY.
OrthoDBi EOG7H4DTH.
PhylomeDBi Q8NHH9.
TreeFami TF105251.

Miscellaneous databases

GenomeRNAii 64225.
NextBioi 35480339.
PROi Q8NHH9.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8NHH9.
Bgeei Q8NHH9.
CleanExi HS_ATL2.
Genevestigatori Q8NHH9.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR003191. Guanylate-bd_C.
IPR015894. Guanylate-bd_N.
IPR027417. P-loop_NTPase.
[Graphical view ]
Pfami PF02263. GBP. 1 hit.
PF02841. GBP_C. 1 hit.
[Graphical view ]
SUPFAMi SSF48340. SSF48340. 1 hit.
SSF52540. SSF52540. 1 hit.
PROSITEi PS51715. G_GB1_RHD3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Physical/genetic map of the 2p22-2p21 region on chromosome 2."
    Gorry M.C., Zhang Y., Marks J.J., Suppe B., Hart P.S., Cortelli J.R., Pallos D., Hart T.C.
    Submitted (NOV-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2), VARIANT ARG-18.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 4 AND 5).
    Tissue: Cerebellum and Testis.
  3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  6. "Cellular localization, oligomerization, and membrane association of the hereditary spastic paraplegia 3A (SPG3A) protein atlastin."
    Zhu P.-P., Patterson A., Lavoie B., Stadler J., Shoeb M., Patel R., Blackstone C.
    J. Biol. Chem. 278:49063-49071(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  7. "Atlastin GTPases are required for Golgi apparatus and ER morphogenesis."
    Rismanchi N., Soderblom C., Stadler J., Zhu P.-P., Blackstone C.
    Hum. Mol. Genet. 17:1591-1604(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TOPOLOGY, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-107 AND ARG-244, TISSUE SPECIFICITY.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-24, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "A class of dynamin-like GTPases involved in the generation of the tubular ER network."
    Hu J., Shibata Y., Zhu P.-P., Voss C., Rismanchi N., Prinz W.A., Rapoport T.A., Blackstone C.
    Cell 138:549-561(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH REEP5 AND RTN3.
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-24, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiATLA2_HUMAN
AccessioniPrimary (citable) accession number: Q8NHH9
Secondary accession number(s): B7Z1X2
, B7Z7X8, Q4ZG30, Q7Z630, Q8NHH8, Q9H5M7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: July 9, 2014
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi