Q8NHE4 (VA0E2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 72.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: V-type proton ATPase subunit e 2 Short name=V-ATPase subunit e 2 Alternative name(s): Lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2 Vacuolar proton pump subunit e 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 81 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells By similarity. |
| Subunit structure | Composed of at least 10 subunits. |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Tissue specificity | Isoform 1 is expressed at high levels in heart, brain and kidney and also detected in inner ear epithelium, vestibule, testis, epididymis and bladder. Isoform 2 is expressed in heart, kidney, placenta and pancreas. Isoform 2 is not detected in frontal cortex, but is prevalent in all other brain areas. Ref.1 |
| Sequence similarities | Belongs to the V-ATPase e1/e2 subunit family. |
| Sequence caution | The sequence AAP97693.1 differs from that shown. Reason: Frameshift at positions 80 and 108. The sequence AAQ96859.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence BAC05292.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence CAE45916.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NHE4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NHE4-2) The sequence of this isoform differs from the canonical sequence as follows: 51-81: FWLIAILAQLNPLFGPQLKNETIWYVRFLWE → LCPALGMTVA...TGQMPGLSPS | ||||||
| Isoform 3 (identifier: Q8NHE4-3) The sequence of this isoform differs from the canonical sequence as follows: 75-81: YVRFLWE → CPALGMTVAP...TGQMPGLSPS | ||||||
| Note: May be due to a competing donor splice site. | ||||||
| Isoform 4 (identifier: Q8NHE4-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MRVRGPARLIASGARLLLRMLSALPGWGPAHLQRPLLGPASCLGILRPAM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 81 | 81 | V-type proton ATPase subunit e 2 | PRO_0000270199 | |||||
Regions | |||||||||
| Transmembrane | 8 – 28 | 21 | Helical; Potential | ||||||
| Transmembrane | 36 – 56 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MRVRGPARLIASGARLLLRM LSALPGWGPAHLQRPLLGPA SCLGILRPAM in isoform 4. | VSP_044857 | |||||
| Alternative sequence | 51 – 81 | 31 | FWLIA…RFLWE → LCPALGMTVAPLSLTTPSSG PSPTQLCLVTSSLLLAPRDP DPQGLPGSWKSSQSSQPARA LGSPGHSSGRGDVLLQYPHC SGVCPLSQGDAAGELVWVGS FPLQTGQMPGLSPS in isoform 2. | VSP_027104 | |||||
| Alternative sequence | 75 – 81 | 7 | YVRFLWE → CPALGMTVAPLSLTTPSSGP SPTQLCLVTSSLLLAPRDPD PQGLPGSWKSSQSSQPARAL GSPGHSSGRGDVLLQYPHCS GVCPLSQGDAAGELVWVGSF PLQTGQMPGLSPS in isoform 3. | VSP_027105 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a novel form of the human vacuolar H+-ATPase e-subunit: an essential proton pump component." Blake-Palmer K.G., Su Y., Smith A.N., Karet F.E. Gene 393:94-100(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 1-61 (ISOFORM 2), TISSUE SPECIFICITY. Tissue: Brain. |
| [2] | Li N., Wan T., Zhang M., Zhang W., Cao X. Submitted (MAY-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | Zan Q., Guo J.H., Yu L. Submitted (NOV-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4). Tissue: Placenta. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cerebellum. |
| [6] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | DQ995344 mRNA. Translation: ABK76305.1. DQ989009 mRNA. Translation: ABK88279.1. AY037164 mRNA. Translation: AAK67647.1. AF452639 mRNA. Translation: AAP97693.1. Frameshift. AK098362 mRNA. Translation: BAC05292.1. Different initiation. BX640846 mRNA. Translation: CAE45916.1. Different initiation. AC093458 Genomic DNA. Translation: AAQ96859.1. Sequence problems. |
| IPI | IPI00413616. IPI00640032. IPI00854692. IPI00942017. |
| RefSeq | NP_001094062.1. NM_001100592.1. NP_660265.2. NM_145230.2. |
| UniGene | Hs.698060. |
3D structure databases | |
| ProteinModelPortal | Q8NHE4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000411672. |
Polymorphism databases | |
| DMDM | 74715659. |
Proteomic databases | |
| PRIDE | Q8NHE4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000425642; ENSP00000396148; ENSG00000171130. ENST00000456496; ENSP00000410220; ENSG00000171130. ENST00000471877; ENSP00000420679; ENSG00000171130. ENST00000479613; ENSP00000417939; ENSG00000171130. |
| GeneID | 155066. |
| KEGG | hsa:155066. |
| UCSC | uc003wgr.3. human. |
Organism-specific databases | |
| CTD | 155066. |
| GeneCards | GC07P149570. |
| H-InvDB | HIX0007198. |
| HGNC | HGNC:21723. ATP6V0E2. |
| MIM | 611019. gene. |
| neXtProt | NX_Q8NHE4. |
| PharmGKB | PA162377277. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG293344. |
| HOGENOM | HOG000265078. |
| HOVERGEN | HBG003974. |
| KO | K02153. |
| OMA | CTAVCCY. |
Enzyme and pathway databases | |
| BioCyc | MetaCyc:HS15951-MONOMER. |
| Reactome | REACT_111102. Signal Transduction. REACT_116125. Disease. REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q8NHE4. |
| Bgee | Q8NHE4. |
| CleanEx | HS_ATP6V0E2. |
| Genevestigator | Q8NHE4. |
Family and domain databases | |
| InterPro | IPR008389. ATPase_V0-cplx_e1/e2_su. IPR017385. ATPase_V0-cplx_e1/e2_su_met. [Graphical view] |
| PANTHER | PTHR12263. PTHR12263. 1 hit. |
| Pfam | PF05493. ATP_synt_H. 1 hit. [Graphical view] |
| PIRSF | PIRSF038097. V-ATP_synth_e1/e2. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ATP6V0E2. human. |
| GenomeRNAi | 155066. |
| NextBio | 35535430. |
| SOURCE | Search... |
Entry information
| Entry name | VA0E2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NHE4 Secondary accession number(s): A2T863 Q8N7I8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
