Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

V-type proton ATPase subunit e 2

Gene

ATP6V0E2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.By similarity

GO - Molecular functioni

GO - Biological processi

  • ATP hydrolysis coupled proton transport Source: InterPro
  • cell growth Source: UniProtKB
  • insulin receptor signaling pathway Source: Reactome
  • ion transmembrane transport Source: Reactome
  • phagosome acidification Source: Reactome
  • regulation of macroautophagy Source: ParkinsonsUK-UCL
  • transferrin transport Source: Reactome
  • vacuolar acidification Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Biological processi

Hydrogen ion transport, Ion transport, Transport

Enzyme and pathway databases

BioCyciMetaCyc:HS15951-MONOMER.
ZFISH:HS15951-MONOMER.
ReactomeiR-HSA-1222556. ROS, RNS production in response to bacteria.
R-HSA-77387. Insulin receptor recycling.
R-HSA-917977. Transferrin endocytosis and recycling.
R-HSA-983712. Ion channel transport.

Names & Taxonomyi

Protein namesi
Recommended name:
V-type proton ATPase subunit e 2
Short name:
V-ATPase subunit e 2
Alternative name(s):
Lysosomal 9 kDa H(+)-transporting ATPase V0 subunit e2
Vacuolar proton pump subunit e 2
Gene namesi
Name:ATP6V0E2
Synonyms:ATP6V0E2L, C7orf32
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:21723. ATP6V0E2.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei8 – 28HelicalSequence analysisAdd BLAST21
Transmembranei36 – 56HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000171130.
PharmGKBiPA162377277.

Polymorphism and mutation databases

DMDMi74715659.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002701991 – 81V-type proton ATPase subunit e 2Add BLAST81

Proteomic databases

PRIDEiQ8NHE4.

Expressioni

Tissue specificityi

Isoform 1 is expressed at high levels in heart, brain and kidney and also detected in inner ear epithelium, vestibule, testis, epididymis and bladder. Isoform 2 is expressed in heart, kidney, placenta and pancreas. Isoform 2 is not detected in frontal cortex, but is prevalent in all other brain areas.1 Publication

Gene expression databases

BgeeiENSG00000171130.
CleanExiHS_ATP6V0E2.
ExpressionAtlasiQ8NHE4. baseline and differential.
GenevisibleiQ8NHE4. HS.

Interactioni

Subunit structurei

Composed of at least 10 subunits.

Protein-protein interaction databases

BioGridi127575. 1 interactor.

Structurei

3D structure databases

ProteinModelPortaliQ8NHE4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the V-ATPase e1/e2 subunit family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000000728.
HOGENOMiHOG000205467.
HOVERGENiHBG003974.
InParanoidiQ8NHE4.
KOiK02153.
OMAiAPWFVPK.
PhylomeDBiQ8NHE4.

Family and domain databases

InterProiIPR008389. ATPase_V0-cplx_e1/e2_su.
IPR017385. ATPase_V0-cplx_e1/e2_su_met.
[Graphical view]
PANTHERiPTHR12263. PTHR12263. 1 hit.
PfamiPF05493. ATP_synt_H. 1 hit.
[Graphical view]
PIRSFiPIRSF038097. V-ATP_synth_e1/e2. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NHE4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTAHSFALPV IIFTTFWGLV GIAGPWFVPK GPNRGVIITM LVATAVCCYL
60 70 80
FWLIAILAQL NPLFGPQLKN ETIWYVRFLW E
Length:81
Mass (Da):9,184
Last modified:October 1, 2002 - v1
Checksum:iFACC53CB431BA445
GO
Isoform 2 (identifier: Q8NHE4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-81: FWLIAILAQLNPLFGPQLKNETIWYVRFLWE → LCPALGMTVA...TGQMPGLSPS

Show »
Length:164
Mass (Da):16,855
Checksum:iD892E2C67F207776
GO
Isoform 3 (identifier: Q8NHE4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     75-81: YVRFLWE → CPALGMTVAP...TGQMPGLSPS

Note: May be due to a competing donor splice site.
Show »
Length:187
Mass (Da):19,550
Checksum:i6F9D4ACD50C88153
GO
Isoform 4 (identifier: Q8NHE4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRVRGPARLIASGARLLLRMLSALPGWGPAHLQRPLLGPASCLGILRPAM

Note: No experimental confirmation available.
Show »
Length:130
Mass (Da):14,348
Checksum:i2F88D3232A67D1EB
GO

Sequence cautioni

The sequence AAP97693 differs from that shown. Reason: Frameshift at positions 80 and 108.Curated
The sequence AAQ96859 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAC05292 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAE45916 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0448571M → MRVRGPARLIASGARLLLRM LSALPGWGPAHLQRPLLGPA SCLGILRPAM in isoform 4. 1 Publication1
Alternative sequenceiVSP_02710451 – 81FWLIA…RFLWE → LCPALGMTVAPLSLTTPSSG PSPTQLCLVTSSLLLAPRDP DPQGLPGSWKSSQSSQPARA LGSPGHSSGRGDVLLQYPHC SGVCPLSQGDAAGELVWVGS FPLQTGQMPGLSPS in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_02710575 – 81YVRFLWE → CPALGMTVAPLSLTTPSSGP SPTQLCLVTSSLLLAPRDPD PQGLPGSWKSSQSSQPARAL GSPGHSSGRGDVLLQYPHCS GVCPLSQGDAAGELVWVGSF PLQTGQMPGLSPS in isoform 3. 1 Publication7

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ995344 mRNA. Translation: ABK76305.1.
DQ989009 mRNA. Translation: ABK88279.1.
AY037164 mRNA. Translation: AAK67647.1.
AF452639 mRNA. Translation: AAP97693.1. Frameshift.
AK098362 mRNA. Translation: BAC05292.1. Different initiation.
BX640846 mRNA. Translation: CAE45916.1. Different initiation.
AC093458 Genomic DNA. Translation: AAQ96859.1. Sequence problems.
CCDSiCCDS55181.1. [Q8NHE4-4]
RefSeqiNP_001094062.1. NM_001100592.2.
NP_001276919.1. NM_001289990.1.
NP_660265.2. NM_145230.3. [Q8NHE4-4]
UniGeneiHs.556998.

Genome annotation databases

EnsembliENST00000425642; ENSP00000396148; ENSG00000171130. [Q8NHE4-1]
ENST00000456496; ENSP00000410220; ENSG00000171130. [Q8NHE4-4]
ENST00000464662; ENSP00000475645; ENSG00000171130. [Q8NHE4-1]
ENST00000471877; ENSP00000420679; ENSG00000171130. [Q8NHE4-1]
ENST00000479613; ENSP00000417939; ENSG00000171130. [Q8NHE4-3]
ENST00000606024; ENSP00000475904; ENSG00000171130. [Q8NHE4-2]
ENST00000615196; ENSP00000481176; ENSG00000171130. [Q8NHE4-4]
GeneIDi155066.
KEGGihsa:155066.
UCSCiuc003wgp.3. human. [Q8NHE4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ995344 mRNA. Translation: ABK76305.1.
DQ989009 mRNA. Translation: ABK88279.1.
AY037164 mRNA. Translation: AAK67647.1.
AF452639 mRNA. Translation: AAP97693.1. Frameshift.
AK098362 mRNA. Translation: BAC05292.1. Different initiation.
BX640846 mRNA. Translation: CAE45916.1. Different initiation.
AC093458 Genomic DNA. Translation: AAQ96859.1. Sequence problems.
CCDSiCCDS55181.1. [Q8NHE4-4]
RefSeqiNP_001094062.1. NM_001100592.2.
NP_001276919.1. NM_001289990.1.
NP_660265.2. NM_145230.3. [Q8NHE4-4]
UniGeneiHs.556998.

3D structure databases

ProteinModelPortaliQ8NHE4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127575. 1 interactor.

Polymorphism and mutation databases

DMDMi74715659.

Proteomic databases

PRIDEiQ8NHE4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000425642; ENSP00000396148; ENSG00000171130. [Q8NHE4-1]
ENST00000456496; ENSP00000410220; ENSG00000171130. [Q8NHE4-4]
ENST00000464662; ENSP00000475645; ENSG00000171130. [Q8NHE4-1]
ENST00000471877; ENSP00000420679; ENSG00000171130. [Q8NHE4-1]
ENST00000479613; ENSP00000417939; ENSG00000171130. [Q8NHE4-3]
ENST00000606024; ENSP00000475904; ENSG00000171130. [Q8NHE4-2]
ENST00000615196; ENSP00000481176; ENSG00000171130. [Q8NHE4-4]
GeneIDi155066.
KEGGihsa:155066.
UCSCiuc003wgp.3. human. [Q8NHE4-1]

Organism-specific databases

CTDi155066.
GeneCardsiATP6V0E2.
H-InvDBHIX0007198.
HGNCiHGNC:21723. ATP6V0E2.
MIMi611019. gene.
neXtProtiNX_Q8NHE4.
OpenTargetsiENSG00000171130.
PharmGKBiPA162377277.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000000728.
HOGENOMiHOG000205467.
HOVERGENiHBG003974.
InParanoidiQ8NHE4.
KOiK02153.
OMAiAPWFVPK.
PhylomeDBiQ8NHE4.

Enzyme and pathway databases

BioCyciMetaCyc:HS15951-MONOMER.
ZFISH:HS15951-MONOMER.
ReactomeiR-HSA-1222556. ROS, RNS production in response to bacteria.
R-HSA-77387. Insulin receptor recycling.
R-HSA-917977. Transferrin endocytosis and recycling.
R-HSA-983712. Ion channel transport.

Miscellaneous databases

ChiTaRSiATP6V0E2. human.
GenomeRNAii155066.
PROiQ8NHE4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000171130.
CleanExiHS_ATP6V0E2.
ExpressionAtlasiQ8NHE4. baseline and differential.
GenevisibleiQ8NHE4. HS.

Family and domain databases

InterProiIPR008389. ATPase_V0-cplx_e1/e2_su.
IPR017385. ATPase_V0-cplx_e1/e2_su_met.
[Graphical view]
PANTHERiPTHR12263. PTHR12263. 1 hit.
PfamiPF05493. ATP_synt_H. 1 hit.
[Graphical view]
PIRSFiPIRSF038097. V-ATP_synth_e1/e2. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiVA0E2_HUMAN
AccessioniPrimary (citable) accession number: Q8NHE4
Secondary accession number(s): A2T863
, A2T8L7, B5MDP5, J3KQW7, Q6MZW1, Q75L47, Q7Z4R7, Q8N7I8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2007
Last sequence update: October 1, 2002
Last modified: November 2, 2016
This is version 100 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.