Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RAD52 motif-containing protein 1

Gene

RDM1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May confer resistance to the antitumor agent cisplatin. Binds to DNA and RNA.1 Publication

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

DNA-binding, RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
RAD52 motif-containing protein 1
Alternative name(s):
RAD52 homolog B
Gene namesi
Name:RDM1
Synonyms:RAD52B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:19950. RDM1.

Subcellular locationi

Isoform 1 :
  • Cytoplasm
  • NucleusPML body
  • NucleusCajal body

  • Note: Isoform 1 is predominantly cytoplasmic. Isoform 1 colocalized with nuclear promyelocytic leukemia (PML) and Cajal bodies (CB); this association with nuclear bodies is enhanced in response to proteotoxic stress.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi98 – 1003RHK → AAA: Reduces its nuclear and nucleolar accumulation. Increases its cytoplasmic accumulation. 1 Publication
Mutagenesisi120 – 1223YYF → AAA: Does not affect its subcellular distribution. 1 Publication

Organism-specific databases

PharmGKBiPA134932526.

Polymorphism and mutation databases

BioMutaiRDM1.
DMDMi74762574.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 284284RAD52 motif-containing protein 1PRO_0000299528Add
BLAST

Proteomic databases

PaxDbiQ8NG50.
PRIDEiQ8NG50.

PTM databases

iPTMnetiQ8NG50.
PhosphoSiteiQ8NG50.

Expressioni

Tissue specificityi

Expressed in testis.1 Publication

Inductioni

Heat-shock stress up-regulated mRNA expression of isoform 10 and isoform 11. Heat-shock stress down-regulated short N-terminal mRNA expression of isoform 2, isoform 4, isoform 6 and isoform 9.1 Publication

Gene expression databases

BgeeiQ8NG50.
CleanExiHS_RDM1.
ExpressionAtlasiQ8NG50. baseline and differential.
GenevisibleiQ8NG50. HS.

Organism-specific databases

HPAiHPA024708.
HPA024794.

Interactioni

Subunit structurei

Homodimer.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
MRFAP1L1Q96HT83EBI-10288724,EBI-748896

Protein-protein interaction databases

BioGridi128384. 3 interactions.
IntActiQ8NG50. 1 interaction.
STRINGi9606.ENSP00000293273.

Structurei

3D structure databases

ProteinModelPortaliQ8NG50.
SMRiQ8NG50. Positions 13-100.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini15 – 9884RRMPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 9292Necessary for nuclear localization and for nucleolar accumulation in response to heat shockAdd
BLAST
Regioni90 – 13344Necessary for nuclear and nucleolar localizationAdd
BLAST

Domaini

C-terminal half (amino acids 134-284) contains cytoplasmic retention domains as well as determinants involved in its stress-induced nucleolar accumulation.

Sequence similaritiesi

Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IFY2. Eukaryota.
ENOG41123Y3. LUCA.
GeneTreeiENSGT00390000018397.
HOGENOMiHOG000015383.
HOVERGENiHBG105575.
InParanoidiQ8NG50.
KOiK10874.
OMAiYDCRSPG.
OrthoDBiEOG7M98H9.
PhylomeDBiQ8NG50.
TreeFamiTF101222.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]

Sequences (12)i

Sequence statusi: Complete.

This entry describes 12 isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NG50-1) [UniParc]FASTAAdd to basket

Also known as: RDM1alpha, Long N-terminal form

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAELVPFAVP IESDKTLLVW ELSSGPTAEA LHHSLFTAFS QFGLLYSVRV
60 70 80 90 100
FPNAAVAHPG FYAVIKFYSA RAAHRAQKAC DRKQLFQKSP VKVRLGTRHK
110 120 130 140 150
AVQHQALALN SSKCQELANY YFGFNGCSKR IIKLQELSDL EERENEDSMV
160 170 180 190 200
PLPKQSLKFF CALEVVLPSC DCRSPGIGLV EEPMDKVEEG PLSFLMKRKT
210 220 230 240 250
AQKLAIQKAL SDAFQKLLIV VLESGKIAVE YRPSEDIVGV RCEEELHGLI
260 270 280
QVPCSPWKQY GQEEEGYLSD FSLEEEEFRL PELD
Note: Produced by alternative promoter usage.
Length:284
Mass (Da):31,970
Last modified:October 1, 2002 - v1
Checksum:iF0C241F094C447E9
GO
Isoform 2 (identifier: Q8NG50-2) [UniParc]FASTAAdd to basket

Also known as: DeltaN-RDM1alpha, Short N-terminal form

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MAELVPFAVPIESDKTLLVWELSSGPTAEALH → MHLLVPPPQ

Note: Produced by alternative promoter usage.
Show »
Length:261
Mass (Da):29,549
Checksum:i96B9D4EE7F67565A
GO
Isoform 3 (identifier: Q8NG50-3) [UniParc]FASTAAdd to basket

Also known as: RDM1beta

The sequence of this isoform differs from the canonical sequence as follows:
     134-139: LQELSD → DHYHSL
     140-284: Missing.

Note: Produced by alternative splicing of isoform 1.
Show »
Length:139
Mass (Da):15,594
Checksum:iFD344AD9A3F17E81
GO
Isoform 4 (identifier: Q8NG50-4) [UniParc]FASTAAdd to basket

Also known as: DeltaN-RDM1beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MAELVPFAVPIESDKTLLVWELSSGPTAEALH → MHLLVPPPQ
     134-139: LQELSD → DHYHSL
     140-284: Missing.

Note: Produced by alternative splicing of isoform 2.
Show »
Length:116
Mass (Da):13,173
Checksum:i5E58FFC59167606A
GO
Isoform 5 (identifier: Q8NG50-5) [UniParc]FASTAAdd to basket

Also known as: RDM1gamma

The sequence of this isoform differs from the canonical sequence as follows:
     190-222: Missing.

Note: Produced by alternative splicing of isoform 1.
Show »
Length:251
Mass (Da):28,317
Checksum:i08458791A5D07A7D
GO
Isoform 6 (identifier: Q8NG50-6) [UniParc]FASTAAdd to basket

Also known as: DeltaN-RDM1gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MAELVPFAVPIESDKTLLVWELSSGPTAEALH → MHLLVPPPQ
     190-222: Missing.

Note: Produced by alternative splicing of isoform 2.
Show »
Length:228
Mass (Da):25,897
Checksum:iC54EE2975C36C54E
GO
Isoform 7 (identifier: Q8NG50-7) [UniParc]FASTAAdd to basket

Also known as: RDM1delta

The sequence of this isoform differs from the canonical sequence as follows:
     33-92: Missing.
     134-139: LQELSD → DHYHSL
     140-284: Missing.

Note: Produced by alternative splicing of isoform 1.
Show »
Length:79
Mass (Da):8,838
Checksum:i09C820E80D642482
GO
Isoform 8 (identifier: Q8NG50-8) [UniParc]FASTAAdd to basket

Also known as: RDM1epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     134-139: LQELSD → KVVK
     140-284: Missing.

Note: Produced by alternative splicing of isoform 1.
Show »
Length:137
Mass (Da):15,296
Checksum:i180020D8EE81F248
GO
Isoform 9 (identifier: Q8NG50-9) [UniParc]FASTAAdd to basket

Also known as: DeltaN-RDM1epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MAELVPFAVPIESDKTLLVWELSSGPTAEALH → MHLLVPPPQ
     134-139: LQELSD → KVVK
     140-284: Missing.

Note: Produced by alternative splicing of isoform 2.
Show »
Length:114
Mass (Da):12,875
Checksum:i6D1C124EF06A2B2C
GO
Isoform 10 (identifier: Q8NG50-10) [UniParc]FASTAAdd to basket

Also known as: RDM1zeta

The sequence of this isoform differs from the canonical sequence as follows:
     134-251: Missing.

Note: Produced by alternative splicing of isoform 1. In cells exposed to a mild heat schock.
Show »
Length:166
Mass (Da):18,773
Checksum:iB80735A83E6952DE
GO
Isoform 11 (identifier: Q8NG50-11) [UniParc]FASTAAdd to basket

Also known as: DeltaN-RDM1zeta

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MAELVPFAVPIESDKTLLVWELSSGPTAEALH → MHLLVPPPQ
     134-251: Missing.

Note: Produced by alternative splicing of isoform 2. In cells exposed to a mild heat schock.
Show »
Length:143
Mass (Da):16,353
Checksum:i1863C73C9A30D14A
GO
Isoform 12 (identifier: Q8NG50-12) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     223-284: ESGKIAVEYR...EEEFRLPELD → GKTVLIILEVLQFQ

Note: No experimental confirmation available.
Show »
Length:236
Mass (Da):26,382
Checksum:i773631D84CD423AA
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti121 – 1211Y → C in BC038301 (PubMed:17905820).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti32 – 321H → R.1 Publication
Corresponds to variant rs2280786 [ dbSNP | Ensembl ].
VAR_034835
Natural varianti127 – 1271C → W.1 Publication
Corresponds to variant rs2251660 [ dbSNP | Ensembl ].
VAR_034836

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3232MAELV…AEALH → MHLLVPPPQ in isoform 2, isoform 4, isoform 6, isoform 9 and isoform 11. 1 PublicationVSP_029648Add
BLAST
Alternative sequencei33 – 9260Missing in isoform 7. 1 PublicationVSP_029649Add
BLAST
Alternative sequencei134 – 251118Missing in isoform 10 and isoform 11. 1 PublicationVSP_029650Add
BLAST
Alternative sequencei134 – 1396LQELSD → DHYHSL in isoform 3, isoform 4 and isoform 7. 1 PublicationVSP_029653
Alternative sequencei134 – 1396LQELSD → KVVK in isoform 8 and isoform 9. 1 PublicationVSP_037151
Alternative sequencei140 – 284145Missing in isoform 3, isoform 4, isoform 7, isoform 8 and isoform 9. 1 PublicationVSP_029654Add
BLAST
Alternative sequencei190 – 22233Missing in isoform 5 and isoform 6. 1 PublicationVSP_029655Add
BLAST
Alternative sequencei223 – 28462ESGKI…LPELD → GKTVLIILEVLQFQ in isoform 12. 1 PublicationVSP_044856Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB080728 mRNA. Translation: BAC02562.1.
EF488473 mRNA. Translation: ABS86950.1.
EF488474 mRNA. Translation: ABS86951.1.
EF488475 mRNA. Translation: ABS86952.1.
EF488476 mRNA. Translation: ABS86953.1.
EF488477 mRNA. Translation: ABS86954.1.
EF488478 mRNA. Translation: ABS86955.1.
EF488479 mRNA. Translation: ABS86956.1.
EF488480 mRNA. Translation: ABS86957.1.
EF488481 mRNA. Translation: ABS86958.1.
EF488482 mRNA. Translation: ABS86959.1.
AC004675 Genomic DNA. No translation available.
AC015849 Genomic DNA. No translation available.
BC038301 mRNA. No translation available.
BC127190 mRNA. Translation: AAI27191.1.
BM559857 mRNA. No translation available.
CCDSiCCDS11301.1. [Q8NG50-1]
CCDS42299.1. [Q8NG50-12]
CCDS54108.1. [Q8NG50-4]
CCDS54109.1. [Q8NG50-2]
CCDS54110.1. [Q8NG50-10]
CCDS54111.1. [Q8NG50-5]
CCDS59280.1. [Q8NG50-11]
CCDS59281.1. [Q8NG50-6]
RefSeqiNP_001030008.1. NM_001034836.1. [Q8NG50-12]
NP_001156592.1. NM_001163120.1. [Q8NG50-10]
NP_001156593.1. NM_001163121.1. [Q8NG50-5]
NP_001156594.1. NM_001163122.1. [Q8NG50-6]
NP_001156596.1. NM_001163124.1. [Q8NG50-11]
NP_001156597.1. NM_001163125.1. [Q8NG50-4]
NP_001156602.1. NM_001163130.1. [Q8NG50-2]
NP_663629.1. NM_145654.3. [Q8NG50-1]
XP_011522812.1. XM_011524510.1. [Q8NG50-3]
XP_011545098.1. XM_011546796.1. [Q8NG50-3]
UniGeneiHs.194411.

Genome annotation databases

EnsembliENST00000611538; ENSP00000478597; ENSG00000276432. [Q8NG50-10]
ENST00000612980; ENSP00000483387; ENSG00000278023. [Q8NG50-10]
ENST00000613308; ENSP00000482288; ENSG00000278023. [Q8NG50-12]
ENST00000613554; ENSP00000481726; ENSG00000276432. [Q8NG50-4]
ENST00000615024; ENSP00000481648; ENSG00000278023. [Q8NG50-4]
ENST00000615288; ENSP00000477869; ENSG00000278023. [Q8NG50-8]
ENST00000615378; ENSP00000480131; ENSG00000278023. [Q8NG50-4]
ENST00000616596; ENSP00000478915; ENSG00000278023. [Q8NG50-5]
ENST00000616735; ENSP00000483566; ENSG00000276432. [Q8NG50-5]
ENST00000617591; ENSP00000479622; ENSG00000278023. [Q8NG50-11]
ENST00000618461; ENSP00000481061; ENSG00000276432. [Q8NG50-1]
ENST00000618511; ENSP00000477995; ENSG00000278023. [Q8NG50-9]
ENST00000619193; ENSP00000482981; ENSG00000278023. [Q8NG50-3]
ENST00000619262; ENSP00000479310; ENSG00000278023. [Q8NG50-2]
ENST00000619368; ENSP00000478131; ENSG00000278023. [Q8NG50-7]
ENST00000619828; ENSP00000483933; ENSG00000278023. [Q8NG50-6]
ENST00000620284; ENSP00000483549; ENSG00000278023. [Q8NG50-1]
ENST00000632131; ENSP00000487602; ENSG00000276432. [Q8NG50-3]
ENST00000632857; ENSP00000488876; ENSG00000276432. [Q8NG50-2]
ENST00000632922; ENSP00000488806; ENSG00000276432. [Q8NG50-11]
ENST00000632931; ENSP00000487935; ENSG00000276432. [Q8NG50-12]
ENST00000633122; ENSP00000488617; ENSG00000276432. [Q8NG50-6]
ENST00000633612; ENSP00000488160; ENSG00000276432. [Q8NG50-9]
ENST00000633984; ENSP00000488583; ENSG00000276432. [Q8NG50-8]
ENST00000634031; ENSP00000487863; ENSG00000276432. [Q8NG50-7]
ENST00000634177; ENSP00000487670; ENSG00000276432. [Q8NG50-4]
GeneIDi201299.
KEGGihsa:201299.
UCSCiuc002hkg.5. human. [Q8NG50-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB080728 mRNA. Translation: BAC02562.1.
EF488473 mRNA. Translation: ABS86950.1.
EF488474 mRNA. Translation: ABS86951.1.
EF488475 mRNA. Translation: ABS86952.1.
EF488476 mRNA. Translation: ABS86953.1.
EF488477 mRNA. Translation: ABS86954.1.
EF488478 mRNA. Translation: ABS86955.1.
EF488479 mRNA. Translation: ABS86956.1.
EF488480 mRNA. Translation: ABS86957.1.
EF488481 mRNA. Translation: ABS86958.1.
EF488482 mRNA. Translation: ABS86959.1.
AC004675 Genomic DNA. No translation available.
AC015849 Genomic DNA. No translation available.
BC038301 mRNA. No translation available.
BC127190 mRNA. Translation: AAI27191.1.
BM559857 mRNA. No translation available.
CCDSiCCDS11301.1. [Q8NG50-1]
CCDS42299.1. [Q8NG50-12]
CCDS54108.1. [Q8NG50-4]
CCDS54109.1. [Q8NG50-2]
CCDS54110.1. [Q8NG50-10]
CCDS54111.1. [Q8NG50-5]
CCDS59280.1. [Q8NG50-11]
CCDS59281.1. [Q8NG50-6]
RefSeqiNP_001030008.1. NM_001034836.1. [Q8NG50-12]
NP_001156592.1. NM_001163120.1. [Q8NG50-10]
NP_001156593.1. NM_001163121.1. [Q8NG50-5]
NP_001156594.1. NM_001163122.1. [Q8NG50-6]
NP_001156596.1. NM_001163124.1. [Q8NG50-11]
NP_001156597.1. NM_001163125.1. [Q8NG50-4]
NP_001156602.1. NM_001163130.1. [Q8NG50-2]
NP_663629.1. NM_145654.3. [Q8NG50-1]
XP_011522812.1. XM_011524510.1. [Q8NG50-3]
XP_011545098.1. XM_011546796.1. [Q8NG50-3]
UniGeneiHs.194411.

3D structure databases

ProteinModelPortaliQ8NG50.
SMRiQ8NG50. Positions 13-100.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128384. 3 interactions.
IntActiQ8NG50. 1 interaction.
STRINGi9606.ENSP00000293273.

PTM databases

iPTMnetiQ8NG50.
PhosphoSiteiQ8NG50.

Polymorphism and mutation databases

BioMutaiRDM1.
DMDMi74762574.

Proteomic databases

PaxDbiQ8NG50.
PRIDEiQ8NG50.

Protocols and materials databases

DNASUi201299.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000611538; ENSP00000478597; ENSG00000276432. [Q8NG50-10]
ENST00000612980; ENSP00000483387; ENSG00000278023. [Q8NG50-10]
ENST00000613308; ENSP00000482288; ENSG00000278023. [Q8NG50-12]
ENST00000613554; ENSP00000481726; ENSG00000276432. [Q8NG50-4]
ENST00000615024; ENSP00000481648; ENSG00000278023. [Q8NG50-4]
ENST00000615288; ENSP00000477869; ENSG00000278023. [Q8NG50-8]
ENST00000615378; ENSP00000480131; ENSG00000278023. [Q8NG50-4]
ENST00000616596; ENSP00000478915; ENSG00000278023. [Q8NG50-5]
ENST00000616735; ENSP00000483566; ENSG00000276432. [Q8NG50-5]
ENST00000617591; ENSP00000479622; ENSG00000278023. [Q8NG50-11]
ENST00000618461; ENSP00000481061; ENSG00000276432. [Q8NG50-1]
ENST00000618511; ENSP00000477995; ENSG00000278023. [Q8NG50-9]
ENST00000619193; ENSP00000482981; ENSG00000278023. [Q8NG50-3]
ENST00000619262; ENSP00000479310; ENSG00000278023. [Q8NG50-2]
ENST00000619368; ENSP00000478131; ENSG00000278023. [Q8NG50-7]
ENST00000619828; ENSP00000483933; ENSG00000278023. [Q8NG50-6]
ENST00000620284; ENSP00000483549; ENSG00000278023. [Q8NG50-1]
ENST00000632131; ENSP00000487602; ENSG00000276432. [Q8NG50-3]
ENST00000632857; ENSP00000488876; ENSG00000276432. [Q8NG50-2]
ENST00000632922; ENSP00000488806; ENSG00000276432. [Q8NG50-11]
ENST00000632931; ENSP00000487935; ENSG00000276432. [Q8NG50-12]
ENST00000633122; ENSP00000488617; ENSG00000276432. [Q8NG50-6]
ENST00000633612; ENSP00000488160; ENSG00000276432. [Q8NG50-9]
ENST00000633984; ENSP00000488583; ENSG00000276432. [Q8NG50-8]
ENST00000634031; ENSP00000487863; ENSG00000276432. [Q8NG50-7]
ENST00000634177; ENSP00000487670; ENSG00000276432. [Q8NG50-4]
GeneIDi201299.
KEGGihsa:201299.
UCSCiuc002hkg.5. human. [Q8NG50-1]

Organism-specific databases

CTDi201299.
GeneCardsiRDM1.
HGNCiHGNC:19950. RDM1.
HPAiHPA024708.
HPA024794.
MIMi612896. gene.
neXtProtiNX_Q8NG50.
PharmGKBiPA134932526.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFY2. Eukaryota.
ENOG41123Y3. LUCA.
GeneTreeiENSGT00390000018397.
HOGENOMiHOG000015383.
HOVERGENiHBG105575.
InParanoidiQ8NG50.
KOiK10874.
OMAiYDCRSPG.
OrthoDBiEOG7M98H9.
PhylomeDBiQ8NG50.
TreeFamiTF101222.

Miscellaneous databases

GenomeRNAii201299.
NextBioi90133.
PROiQ8NG50.
SOURCEiSearch...

Gene expression databases

BgeeiQ8NG50.
CleanExiHS_RDM1.
ExpressionAtlasiQ8NG50. baseline and differential.
GenevisibleiQ8NG50. HS.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SUPFAMiSSF54928. SSF54928. 1 hit.
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "RDM1, a novel RNA recognition motif (RRM)-containing protein involved in the cell response to cisplatin in vertebrates."
    Hamimes S., Arakawa H., Stasiak A.Z., Kierzek A.M., Hirano S., Yang Y.-G., Takata M., Stasiak A., Buerstedde J.M., Van Dyck E.
    J. Biol. Chem. 280:9225-9235(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY.
  2. "Subcellular distribution of human RDM1 protein isoforms and their nucleolar accumulation in response to heat shock and proteotoxic stress."
    Messaoudi L., Yang Y.-G., Kinomura A., Stavreva D.A., Yan G., Bortolin-Cavaille M.-L., Arakawa H., Buerstedde J.-M., Hainaut P., Cavaille J., Takata M., Van Dyck E.
    Nucleic Acids Res. 35:6571-6587(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4; 5; 6; 7; 8; 9; 10 AND 11), SUBCELLULAR LOCATION, INDUCTION, MUTAGENESIS OF 98-ARG--LYS-100 AND 120-TYR--PHE-122, ALTERNATIVE PROMOTER USAGE, ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8; 9; 10 AND 11).
  3. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 12), VARIANTS ARG-32 AND TRP-127.

Entry informationi

Entry nameiRDM1_HUMAN
AccessioniPrimary (citable) accession number: Q8NG50
Secondary accession number(s): A0JP55
, A8MV46, A8MY68, A8MZ92, A8RCS5, A8RCT0, A8RCT5, A8RCT8, A8RCU3, A8RCU8, A8RCW0, A8RCW5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: October 1, 2002
Last modified: March 16, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.