Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NFZ0

- FBX18_HUMAN

UniProt

Q8NFZ0 - FBX18_HUMAN

Protein

F-box only protein 18

Gene

FBXO18

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 118 (01 Oct 2014)
      Sequence version 2 (15 Mar 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    DNA-dependent ATPase. Unwinds double-stranded DNA in a 3' to 5' direction.1 Publication
    Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.1 Publication

    Catalytic activityi

    ATP + H2O = ADP + phosphate.

    GO - Molecular functioni

    1. ATP binding Source: UniProtKB-KW
    2. ATP-dependent DNA helicase activity Source: InterPro
    3. DNA binding Source: UniProtKB-KW
    4. protein binding Source: IntAct

    GO - Biological processi

    1. DNA catabolic process, endonucleolytic Source: MGI
    2. positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage Source: MGI
    3. positive regulation of protein phosphorylation Source: MGI
    4. response to intra-S DNA damage checkpoint signaling Source: MGI

    Keywords - Molecular functioni

    Helicase, Hydrolase

    Keywords - Biological processi

    Ubl conjugation pathway

    Keywords - Ligandi

    ATP-binding, DNA-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    F-box only protein 18 (EC:3.6.4.12)
    Alternative name(s):
    F-box DNA helicase 1
    Gene namesi
    Name:FBXO18
    Synonyms:FBH1, FBX18
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:13620. FBXO18.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134948258.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10431043F-box only protein 18PRO_0000119901Add
    BLAST

    Proteomic databases

    MaxQBiQ8NFZ0.
    PaxDbiQ8NFZ0.
    PRIDEiQ8NFZ0.

    PTM databases

    PhosphoSiteiQ8NFZ0.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8NFZ0.
    BgeeiQ8NFZ0.
    GenevestigatoriQ8NFZ0.

    Organism-specific databases

    HPAiHPA002844.

    Interactioni

    Subunit structurei

    Part of a SCF E3 ubiquitin ligase complex consisting of SKP1, CUL1, RBX1 and FBXO18. Interacts with SKP1.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    SRCP129314EBI-724767,EBI-621482

    Protein-protein interaction databases

    BioGridi124333. 9 interactions.
    IntActiQ8NFZ0. 5 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NFZ0.
    SMRiQ8NFZ0. Positions 640-716.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini138 – 18447F-boxPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the helicase family. UvrD subfamily.Curated
    Contains 1 F-box domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0210.
    HOVERGENiHBG051568.
    InParanoidiQ8NFZ0.
    KOiK10300.
    OMAiVFPSNVI.
    OrthoDBiEOG725DGV.
    PhylomeDBiQ8NFZ0.
    TreeFamiTF329020.

    Family and domain databases

    Gene3Di3.40.50.300. 3 hits.
    InterProiIPR014017. DNA_helicase_UvrD-like_C.
    IPR000212. DNA_helicase_UvrD/REP.
    IPR001810. F-box_dom.
    IPR027417. P-loop_NTPase.
    IPR014016. UvrD-like_ATP-bd.
    [Graphical view]
    PANTHERiPTHR11070. PTHR11070. 1 hit.
    PfamiPF12937. F-box-like. 1 hit.
    PF00580. UvrD-helicase. 1 hit.
    PF13361. UvrD_C. 1 hit.
    [Graphical view]
    SMARTiSM00256. FBOX. 1 hit.
    [Graphical view]
    SUPFAMiSSF52540. SSF52540. 3 hits.
    SSF81383. SSF81383. 1 hit.
    PROSITEiPS50181. FBOX. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NFZ0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRRFKRKHLT AIDCQHLARS HLAVTQPFGQ RWTNRDPNHG LYPKPRTKRG     50
    SRGQGSQRCI PEFFLAGKQP CTNDMAKSNS VGQDSCQDSE GDMIFPAESS 100
    CALPQEGSAG PGSPGSAPPS RKRSWSSEEE SNQATGTSRW DGVSKKAPRH 150
    HLSVPCTRPR EARQEAEDST SRLSAESGET DQDAGDVGPD PIPDSYYGLL 200
    GTLPCQEALS HICSLPSEVL RHVFAFLPVE DLYWNLSLVC HLWREIISDP 250
    LFIPWKKLYH RYLMNEEQAV SKVDGILSNC GIEKESDLCV LNLIRYTATT 300
    KCSPSVDPER VLWSLRDHPL LPEAEACVRQ HLPDLYAAAG GVNIWALVAA 350
    VVLLSSSVND IQRLLFCLRR PSSTVTMPDV TETLYCIAVL LYAMREKGIN 400
    ISNRIHYNIF YCLYLQENSC TQATKVKEEP SVWPGKKTIQ LTHEQQLILN 450
    HKMEPLQVVK IMAFAGTGKT STLVKYAEKW SQSRFLYVTF NKSIAKQAER 500
    VFPSNVICKT FHSMAYGHIG RKYQSKKKLN LFKLTPFMVN SVLAEGKGGF 550
    IRAKLVCKTL ENFFASADEE LTIDHVPIWC KNSQGQRVMV EQSEKLNGVL 600
    EASRLWDNMR KLGECTEEAH QMTHDGYLKL WQLSKPSLAS FDAIFVDEAQ 650
    DCTPAIMNIV LSQPCGKIFV GDPHQQIYTF RGAVNALFTV PHTHVFYLTQ 700
    SFRFGVEIAY VGATILDVCK RVRKKTLVGG NHQSGIRGDA KGQVALLSRT 750
    NANVFDEAVR VTEGEFPSRI HLIGGIKSFG LDRIIDIWIL LQPEEERRKQ 800
    NLVIKDKFIR RWVHKEGFSG FKRYVTAAED KELEAKIAVV EKYNIRIPEL 850
    VQRIEKCHIE DLDFAEYILG TVHKAKGLEF DTVHVLDDFV KVPCARHNLP 900
    QLPHFRVESF SEDEWNLLYV AVTRAKKRLI MTKSLENILT LAGEYFLQAE 950
    LTSNVLKTGV VRCCVGQCNN AIPVDTVLTM KKLPITYSNR KENKGGYLCH 1000
    SCAEQRIGPL AFLTASPEQV RAMERTVENI VLPRHEALLF LVF 1043
    Length:1,043
    Mass (Da):117,686
    Last modified:March 15, 2004 - v2
    Checksum:iE20EB343E9D05C4D
    GO
    Isoform 2 (identifier: Q8NFZ0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MSYEVTSGCHWTCQVPESCDNGLHCAGPLGHLHRRCQRTSAHLLVFTEHAEM

    Note: No experimental confirmation available.

    Show »
    Length:1,094
    Mass (Da):123,375
    Checksum:iF2A3ED56FBC690B4
    GO

    Sequence cautioni

    The sequence AAM73631.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB55073.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAB55154.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti234 – 2341W → R in BAC04535. (PubMed:14702039)Curated
    Sequence conflicti339 – 3391Missing in AAP97700. 1 PublicationCurated
    Sequence conflicti339 – 3391Missing in BAB55154. (PubMed:14702039)Curated
    Sequence conflicti425 – 4251K → N in AAP97705. 1 PublicationCurated
    Sequence conflicti844 – 8441N → S in BAC04535. (PubMed:14702039)Curated
    Sequence conflicti984 – 9841P → L in AAP97700. 1 PublicationCurated
    Sequence conflicti984 – 9841P → L in BAB55154. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MSYEVTSGCHWTCQVPESCD NGLHCAGPLGHLHRRCQRTS AHLLVFTEHAEM in isoform 2. 1 PublicationVSP_037942

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF380349 mRNA. Translation: AAM73631.1. Different initiation.
    AF454502 mRNA. Translation: AAP97700.1.
    AF456237 mRNA. Translation: AAP97705.1.
    AK027381 mRNA. Translation: BAB55073.1. Different initiation.
    AK027496 mRNA. Translation: BAB55154.1. Different initiation.
    AK095343 mRNA. Translation: BAC04535.1.
    AL137186 Genomic DNA. Translation: CAI41073.1.
    AL137186 Genomic DNA. Translation: CAI41074.1.
    CH471072 Genomic DNA. Translation: EAW86426.1.
    BC012762 mRNA. Translation: AAH12762.2.
    BC032674 mRNA. Translation: AAH32674.2.
    BC113377 mRNA. Translation: AAI13378.1.
    AL133069 mRNA. Translation: CAB61392.1.
    CCDSiCCDS7072.1. [Q8NFZ0-1]
    CCDS7073.1. [Q8NFZ0-2]
    PIRiT42669.
    RefSeqiNP_001245381.1. NM_001258452.1.
    NP_001245382.1. NM_001258453.1.
    NP_116196.3. NM_032807.4. [Q8NFZ0-2]
    NP_835363.1. NM_178150.2. [Q8NFZ0-1]
    XP_006717580.1. XM_006717517.1. [Q8NFZ0-1]
    UniGeneiHs.498543.

    Genome annotation databases

    EnsembliENST00000362091; ENSP00000355415; ENSG00000134452. [Q8NFZ0-1]
    ENST00000379999; ENSP00000369335; ENSG00000134452. [Q8NFZ0-2]
    GeneIDi84893.
    KEGGihsa:84893.
    UCSCiuc001iir.4. human. [Q8NFZ0-1]
    uc001iit.4. human. [Q8NFZ0-2]

    Polymorphism databases

    DMDMi45476952.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF380349 mRNA. Translation: AAM73631.1 . Different initiation.
    AF454502 mRNA. Translation: AAP97700.1 .
    AF456237 mRNA. Translation: AAP97705.1 .
    AK027381 mRNA. Translation: BAB55073.1 . Different initiation.
    AK027496 mRNA. Translation: BAB55154.1 . Different initiation.
    AK095343 mRNA. Translation: BAC04535.1 .
    AL137186 Genomic DNA. Translation: CAI41073.1 .
    AL137186 Genomic DNA. Translation: CAI41074.1 .
    CH471072 Genomic DNA. Translation: EAW86426.1 .
    BC012762 mRNA. Translation: AAH12762.2 .
    BC032674 mRNA. Translation: AAH32674.2 .
    BC113377 mRNA. Translation: AAI13378.1 .
    AL133069 mRNA. Translation: CAB61392.1 .
    CCDSi CCDS7072.1. [Q8NFZ0-1 ]
    CCDS7073.1. [Q8NFZ0-2 ]
    PIRi T42669.
    RefSeqi NP_001245381.1. NM_001258452.1.
    NP_001245382.1. NM_001258453.1.
    NP_116196.3. NM_032807.4. [Q8NFZ0-2 ]
    NP_835363.1. NM_178150.2. [Q8NFZ0-1 ]
    XP_006717580.1. XM_006717517.1. [Q8NFZ0-1 ]
    UniGenei Hs.498543.

    3D structure databases

    ProteinModelPortali Q8NFZ0.
    SMRi Q8NFZ0. Positions 640-716.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124333. 9 interactions.
    IntActi Q8NFZ0. 5 interactions.

    PTM databases

    PhosphoSitei Q8NFZ0.

    Polymorphism databases

    DMDMi 45476952.

    Proteomic databases

    MaxQBi Q8NFZ0.
    PaxDbi Q8NFZ0.
    PRIDEi Q8NFZ0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000362091 ; ENSP00000355415 ; ENSG00000134452 . [Q8NFZ0-1 ]
    ENST00000379999 ; ENSP00000369335 ; ENSG00000134452 . [Q8NFZ0-2 ]
    GeneIDi 84893.
    KEGGi hsa:84893.
    UCSCi uc001iir.4. human. [Q8NFZ0-1 ]
    uc001iit.4. human. [Q8NFZ0-2 ]

    Organism-specific databases

    CTDi 84893.
    GeneCardsi GC10P005931.
    HGNCi HGNC:13620. FBXO18.
    HPAi HPA002844.
    MIMi 607222. gene.
    neXtProti NX_Q8NFZ0.
    PharmGKBi PA134948258.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0210.
    HOVERGENi HBG051568.
    InParanoidi Q8NFZ0.
    KOi K10300.
    OMAi VFPSNVI.
    OrthoDBi EOG725DGV.
    PhylomeDBi Q8NFZ0.
    TreeFami TF329020.

    Miscellaneous databases

    ChiTaRSi FBXO18. human.
    GenomeRNAii 84893.
    NextBioi 75230.
    PROi Q8NFZ0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8NFZ0.
    Bgeei Q8NFZ0.
    Genevestigatori Q8NFZ0.

    Family and domain databases

    Gene3Di 3.40.50.300. 3 hits.
    InterProi IPR014017. DNA_helicase_UvrD-like_C.
    IPR000212. DNA_helicase_UvrD/REP.
    IPR001810. F-box_dom.
    IPR027417. P-loop_NTPase.
    IPR014016. UvrD-like_ATP-bd.
    [Graphical view ]
    PANTHERi PTHR11070. PTHR11070. 1 hit.
    Pfami PF12937. F-box-like. 1 hit.
    PF00580. UvrD-helicase. 1 hit.
    PF13361. UvrD_C. 1 hit.
    [Graphical view ]
    SMARTi SM00256. FBOX. 1 hit.
    [Graphical view ]
    SUPFAMi SSF52540. SSF52540. 3 hits.
    SSF81383. SSF81383. 1 hit.
    PROSITEi PS50181. FBOX. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH SKP1, IDENTIFICATION IN SCF COMPLEX.
    2. Zan Q., Guo J.H., Yu L.
      Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Choriocarcinoma and Testis.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Mammary gland, Testis carcinoma and Tongue.
    4. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain, Pancreas and Testis.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 763-1043 (ISOFORMS 1/2).
      Tissue: Testis.

    Entry informationi

    Entry nameiFBX18_HUMAN
    AccessioniPrimary (citable) accession number: Q8NFZ0
    Secondary accession number(s): Q5JVB0
    , Q5JVB1, Q7Z4Q6, Q7Z4R0, Q8N1P5, Q8N586, Q96E82, Q96K67, Q96SW7, Q9UFB2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 15, 2004
    Last sequence update: March 15, 2004
    Last modified: October 1, 2014
    This is version 118 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3