Q8NFZ0 (FBX18_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: F-box only protein 18 EC=3.6.4.12 Alternative name(s): F-box DNA helicase 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1043 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | DNA-dependent ATPase. Unwinds double-stranded DNA in a 3' to 5' direction. Ref.1 Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation. Ref.1 |
| Catalytic activity | ATP + H2O = ADP + phosphate. |
| Subunit structure | Part of a SCF E3 ubiquitin ligase complex consisting of SKP1, CUL1, RBX1 and FBXO18. Interacts with SKP1. Ref.1 |
| Subcellular location | Nucleus Probable. |
| Sequence similarities | Belongs to the helicase family. UvrD subfamily. Contains 1 F-box domain. |
| Sequence caution | The sequence AAM73631.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB55073.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB55154.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | ATP-binding DNA-binding Nucleotide-binding |
| Molecular function | Helicase Hydrolase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | nucleus Inferred from direct assay. Source: HPA |
| Molecular_function | ATP binding Inferred from electronic annotation. Source: UniProtKB-KW ATP-dependent DNA helicase activityInferred from electronic annotation. Source: InterPro DNA bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NFZ0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NFZ0-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSYEVTSGCHWTCQVPESCDNGLHCAGPLGHLHRRCQRTSAHLLVFTEHAEM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1043 | 1043 | F-box only protein 18 | PRO_0000119901 | |||||
Regions | |||||||||
| Domain | 138 – 184 | 47 | F-box | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MSYEVTSGCHWTCQVPESCD NGLHCAGPLGHLHRRCQRTS AHLLVFTEHAEM in isoform 2. | VSP_037942 | |||||
Experimental info | |||||||||
| Sequence conflict | 234 | 1 | W → R in BAC04535. Ref.3 | ||||||
| Sequence conflict | 339 | 1 | Missing in AAP97700. Ref.2 | ||||||
| Sequence conflict | 339 | 1 | Missing in BAB55154. Ref.3 | ||||||
| Sequence conflict | 425 | 1 | K → N in AAP97705. Ref.2 | ||||||
| Sequence conflict | 844 | 1 | N → S in BAC04535. Ref.3 | ||||||
| Sequence conflict | 984 | 1 | P → L in AAP97700. Ref.2 | ||||||
| Sequence conflict | 984 | 1 | P → L in BAB55154. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF380349 mRNA. Translation: AAM73631.1. Different initiation. AF454502 mRNA. Translation: AAP97700.1. AF456237 mRNA. Translation: AAP97705.1. AK027381 mRNA. Translation: BAB55073.1. Different initiation. AK027496 mRNA. Translation: BAB55154.1. Different initiation. AK095343 mRNA. Translation: BAC04535.1. AL137186 Genomic DNA. Translation: CAI41073.1. AL137186 Genomic DNA. Translation: CAI41074.1. CH471072 Genomic DNA. Translation: EAW86426.1. BC012762 mRNA. Translation: AAH12762.2. BC032674 mRNA. Translation: AAH32674.2. BC113377 mRNA. Translation: AAI13378.1. AL133069 mRNA. Translation: CAB61392.1. |
| IPI | IPI00375254. IPI00409721. |
| PIR | T42669. |
| RefSeq | NP_001245381.1. NM_001258452.1. NP_001245382.1. NM_001258453.1. NP_116196.3. NM_032807.4. NP_835363.1. NM_178150.2. |
| UniGene | Hs.498543. |
3D structure databases | |
| ProteinModelPortal | Q8NFZ0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8NFZ0. 3 interactions. |
PTM databases | |
| PhosphoSite | Q8NFZ0. |
Polymorphism databases | |
| DMDM | 45476952. |
Proteomic databases | |
| PaxDb | Q8NFZ0. |
| PRIDE | Q8NFZ0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000362091; ENSP00000355415; ENSG00000134452. ENST00000379999; ENSP00000369335; ENSG00000134452. |
| GeneID | 84893. |
| KEGG | hsa:84893. |
| UCSC | uc001iir.3. human. uc001iit.3. human. |
Organism-specific databases | |
| CTD | 84893. |
| GeneCards | GC10P005931. |
| HGNC | HGNC:13620. FBXO18. |
| HPA | HPA002844. |
| MIM | 607222. gene. |
| neXtProt | NX_Q8NFZ0. |
| PharmGKB | PA134948258. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0210. |
| HOVERGEN | HBG051568. |
| InParanoid | Q8NFZ0. |
| KO | K10300. |
| OMA | FPSNVIC. |
| OrthoDB | EOG4G7BZ4. |
Gene expression databases | |
| ArrayExpress | Q8NFZ0. |
| Bgee | Q8NFZ0. |
| Genevestigator | Q8NFZ0. |
| GermOnline | ENSG00000134452. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR014017. DNA_helicase_UvrD-like_C. IPR000212. DNA_helicase_UvrD/REP. IPR001810. F-box_dom_cyclin-like. IPR014016. UvrD-like_ATP-bd. [Graphical view] |
| PANTHER | PTHR11070. PTHR11070. 1 hit. |
| Pfam | PF00580. UvrD-helicase. 1 hit. PF13361. UvrD_C. 1 hit. [Graphical view] |
| SMART | SM00256. FBOX. 1 hit. [Graphical view] |
| SUPFAM | SSF81383. F-box_dom_Skp2-like. 1 hit. |
| PROSITE | PS50181. FBOX. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | FBXO18. human. |
| GenomeRNAi | 84893. |
| NextBio | 75230. |
| SOURCE | Search... |
Entry information
| Entry name | FBX18_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NFZ0 Secondary accession number(s): Q5JVB0 Q9UFB2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
