Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NFZ0

- FBX18_HUMAN

UniProt

Q8NFZ0 - FBX18_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

F-box only protein 18

Gene

FBXO18

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

DNA-dependent ATPase. Unwinds double-stranded DNA in a 3' to 5' direction.1 Publication
Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation.1 Publication

Catalytic activityi

ATP + H2O = ADP + phosphate.

GO - Molecular functioni

  1. ATP binding Source: UniProtKB-KW
  2. ATP-dependent DNA helicase activity Source: InterPro
  3. DNA binding Source: UniProtKB-KW

GO - Biological processi

  1. DNA catabolic process, endonucleolytic Source: MGI
  2. positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage Source: MGI
  3. positive regulation of protein phosphorylation Source: MGI
  4. response to intra-S DNA damage checkpoint signaling Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Helicase, Hydrolase

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

ATP-binding, DNA-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
F-box only protein 18 (EC:3.6.4.12)
Alternative name(s):
F-box DNA helicase 1
Gene namesi
Name:FBXO18
Synonyms:FBH1, FBX18
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 10

Organism-specific databases

HGNCiHGNC:13620. FBXO18.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134948258.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10431043F-box only protein 18PRO_0000119901Add
BLAST

Proteomic databases

MaxQBiQ8NFZ0.
PaxDbiQ8NFZ0.
PRIDEiQ8NFZ0.

PTM databases

PhosphoSiteiQ8NFZ0.

Expressioni

Gene expression databases

BgeeiQ8NFZ0.
ExpressionAtlasiQ8NFZ0. baseline.
GenevestigatoriQ8NFZ0.

Organism-specific databases

HPAiHPA002844.

Interactioni

Subunit structurei

Part of a SCF E3 ubiquitin ligase complex consisting of SKP1, CUL1, RBX1 and FBXO18. Interacts with SKP1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
SRCP129314EBI-724767,EBI-621482

Protein-protein interaction databases

BioGridi124333. 11 interactions.
IntActiQ8NFZ0. 5 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ8NFZ0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini138 – 18447F-boxPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the helicase family. UvrD subfamily.Curated
Contains 1 F-box domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0210.
GeneTreeiENSGT00390000011669.
HOVERGENiHBG051568.
InParanoidiQ8NFZ0.
KOiK10300.
OMAiVFPSNVI.
OrthoDBiEOG725DGV.
PhylomeDBiQ8NFZ0.
TreeFamiTF329020.

Family and domain databases

Gene3Di3.40.50.300. 3 hits.
InterProiIPR014017. DNA_helicase_UvrD-like_C.
IPR000212. DNA_helicase_UvrD/REP.
IPR001810. F-box_dom.
IPR027417. P-loop_NTPase.
IPR014016. UvrD-like_ATP-bd.
[Graphical view]
PANTHERiPTHR11070. PTHR11070. 1 hit.
PfamiPF12937. F-box-like. 1 hit.
PF00580. UvrD-helicase. 1 hit.
PF13361. UvrD_C. 1 hit.
[Graphical view]
SMARTiSM00256. FBOX. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 3 hits.
SSF81383. SSF81383. 1 hit.
PROSITEiPS50181. FBOX. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8NFZ0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRFKRKHLT AIDCQHLARS HLAVTQPFGQ RWTNRDPNHG LYPKPRTKRG
60 70 80 90 100
SRGQGSQRCI PEFFLAGKQP CTNDMAKSNS VGQDSCQDSE GDMIFPAESS
110 120 130 140 150
CALPQEGSAG PGSPGSAPPS RKRSWSSEEE SNQATGTSRW DGVSKKAPRH
160 170 180 190 200
HLSVPCTRPR EARQEAEDST SRLSAESGET DQDAGDVGPD PIPDSYYGLL
210 220 230 240 250
GTLPCQEALS HICSLPSEVL RHVFAFLPVE DLYWNLSLVC HLWREIISDP
260 270 280 290 300
LFIPWKKLYH RYLMNEEQAV SKVDGILSNC GIEKESDLCV LNLIRYTATT
310 320 330 340 350
KCSPSVDPER VLWSLRDHPL LPEAEACVRQ HLPDLYAAAG GVNIWALVAA
360 370 380 390 400
VVLLSSSVND IQRLLFCLRR PSSTVTMPDV TETLYCIAVL LYAMREKGIN
410 420 430 440 450
ISNRIHYNIF YCLYLQENSC TQATKVKEEP SVWPGKKTIQ LTHEQQLILN
460 470 480 490 500
HKMEPLQVVK IMAFAGTGKT STLVKYAEKW SQSRFLYVTF NKSIAKQAER
510 520 530 540 550
VFPSNVICKT FHSMAYGHIG RKYQSKKKLN LFKLTPFMVN SVLAEGKGGF
560 570 580 590 600
IRAKLVCKTL ENFFASADEE LTIDHVPIWC KNSQGQRVMV EQSEKLNGVL
610 620 630 640 650
EASRLWDNMR KLGECTEEAH QMTHDGYLKL WQLSKPSLAS FDAIFVDEAQ
660 670 680 690 700
DCTPAIMNIV LSQPCGKIFV GDPHQQIYTF RGAVNALFTV PHTHVFYLTQ
710 720 730 740 750
SFRFGVEIAY VGATILDVCK RVRKKTLVGG NHQSGIRGDA KGQVALLSRT
760 770 780 790 800
NANVFDEAVR VTEGEFPSRI HLIGGIKSFG LDRIIDIWIL LQPEEERRKQ
810 820 830 840 850
NLVIKDKFIR RWVHKEGFSG FKRYVTAAED KELEAKIAVV EKYNIRIPEL
860 870 880 890 900
VQRIEKCHIE DLDFAEYILG TVHKAKGLEF DTVHVLDDFV KVPCARHNLP
910 920 930 940 950
QLPHFRVESF SEDEWNLLYV AVTRAKKRLI MTKSLENILT LAGEYFLQAE
960 970 980 990 1000
LTSNVLKTGV VRCCVGQCNN AIPVDTVLTM KKLPITYSNR KENKGGYLCH
1010 1020 1030 1040
SCAEQRIGPL AFLTASPEQV RAMERTVENI VLPRHEALLF LVF
Length:1,043
Mass (Da):117,686
Last modified:March 15, 2004 - v2
Checksum:iE20EB343E9D05C4D
GO
Isoform 2 (identifier: Q8NFZ0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSYEVTSGCHWTCQVPESCDNGLHCAGPLGHLHRRCQRTSAHLLVFTEHAEM

Note: No experimental confirmation available.

Show »
Length:1,094
Mass (Da):123,375
Checksum:iF2A3ED56FBC690B4
GO

Sequence cautioni

The sequence AAM73631.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB55073.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB55154.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti234 – 2341W → R in BAC04535. (PubMed:14702039)Curated
Sequence conflicti339 – 3391Missing in AAP97700. 1 PublicationCurated
Sequence conflicti339 – 3391Missing in BAB55154. (PubMed:14702039)Curated
Sequence conflicti425 – 4251K → N in AAP97705. 1 PublicationCurated
Sequence conflicti844 – 8441N → S in BAC04535. (PubMed:14702039)Curated
Sequence conflicti984 – 9841P → L in AAP97700. 1 PublicationCurated
Sequence conflicti984 – 9841P → L in BAB55154. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MSYEVTSGCHWTCQVPESCD NGLHCAGPLGHLHRRCQRTS AHLLVFTEHAEM in isoform 2. 1 PublicationVSP_037942

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF380349 mRNA. Translation: AAM73631.1. Different initiation.
AF454502 mRNA. Translation: AAP97700.1.
AF456237 mRNA. Translation: AAP97705.1.
AK027381 mRNA. Translation: BAB55073.1. Different initiation.
AK027496 mRNA. Translation: BAB55154.1. Different initiation.
AK095343 mRNA. Translation: BAC04535.1.
AL137186 Genomic DNA. Translation: CAI41073.1.
AL137186 Genomic DNA. Translation: CAI41074.1.
CH471072 Genomic DNA. Translation: EAW86426.1.
BC012762 mRNA. Translation: AAH12762.2.
BC032674 mRNA. Translation: AAH32674.2.
BC113377 mRNA. Translation: AAI13378.1.
AL133069 mRNA. Translation: CAB61392.1.
CCDSiCCDS7072.1. [Q8NFZ0-1]
CCDS7073.1. [Q8NFZ0-2]
PIRiT42669.
RefSeqiNP_001245381.1. NM_001258452.1.
NP_001245382.1. NM_001258453.1.
NP_116196.3. NM_032807.4. [Q8NFZ0-2]
NP_835363.1. NM_178150.2. [Q8NFZ0-1]
XP_006717580.1. XM_006717517.1. [Q8NFZ0-1]
UniGeneiHs.498543.

Genome annotation databases

EnsembliENST00000362091; ENSP00000355415; ENSG00000134452. [Q8NFZ0-1]
ENST00000379999; ENSP00000369335; ENSG00000134452. [Q8NFZ0-2]
GeneIDi84893.
KEGGihsa:84893.
UCSCiuc001iir.4. human. [Q8NFZ0-1]
uc001iit.4. human. [Q8NFZ0-2]

Polymorphism databases

DMDMi45476952.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF380349 mRNA. Translation: AAM73631.1 . Different initiation.
AF454502 mRNA. Translation: AAP97700.1 .
AF456237 mRNA. Translation: AAP97705.1 .
AK027381 mRNA. Translation: BAB55073.1 . Different initiation.
AK027496 mRNA. Translation: BAB55154.1 . Different initiation.
AK095343 mRNA. Translation: BAC04535.1 .
AL137186 Genomic DNA. Translation: CAI41073.1 .
AL137186 Genomic DNA. Translation: CAI41074.1 .
CH471072 Genomic DNA. Translation: EAW86426.1 .
BC012762 mRNA. Translation: AAH12762.2 .
BC032674 mRNA. Translation: AAH32674.2 .
BC113377 mRNA. Translation: AAI13378.1 .
AL133069 mRNA. Translation: CAB61392.1 .
CCDSi CCDS7072.1. [Q8NFZ0-1 ]
CCDS7073.1. [Q8NFZ0-2 ]
PIRi T42669.
RefSeqi NP_001245381.1. NM_001258452.1.
NP_001245382.1. NM_001258453.1.
NP_116196.3. NM_032807.4. [Q8NFZ0-2 ]
NP_835363.1. NM_178150.2. [Q8NFZ0-1 ]
XP_006717580.1. XM_006717517.1. [Q8NFZ0-1 ]
UniGenei Hs.498543.

3D structure databases

ProteinModelPortali Q8NFZ0.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124333. 11 interactions.
IntActi Q8NFZ0. 5 interactions.

PTM databases

PhosphoSitei Q8NFZ0.

Polymorphism databases

DMDMi 45476952.

Proteomic databases

MaxQBi Q8NFZ0.
PaxDbi Q8NFZ0.
PRIDEi Q8NFZ0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000362091 ; ENSP00000355415 ; ENSG00000134452 . [Q8NFZ0-1 ]
ENST00000379999 ; ENSP00000369335 ; ENSG00000134452 . [Q8NFZ0-2 ]
GeneIDi 84893.
KEGGi hsa:84893.
UCSCi uc001iir.4. human. [Q8NFZ0-1 ]
uc001iit.4. human. [Q8NFZ0-2 ]

Organism-specific databases

CTDi 84893.
GeneCardsi GC10P005931.
HGNCi HGNC:13620. FBXO18.
HPAi HPA002844.
MIMi 607222. gene.
neXtProti NX_Q8NFZ0.
PharmGKBi PA134948258.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0210.
GeneTreei ENSGT00390000011669.
HOVERGENi HBG051568.
InParanoidi Q8NFZ0.
KOi K10300.
OMAi VFPSNVI.
OrthoDBi EOG725DGV.
PhylomeDBi Q8NFZ0.
TreeFami TF329020.

Miscellaneous databases

ChiTaRSi FBXO18. human.
GenomeRNAii 84893.
NextBioi 75230.
PROi Q8NFZ0.
SOURCEi Search...

Gene expression databases

Bgeei Q8NFZ0.
ExpressionAtlasi Q8NFZ0. baseline.
Genevestigatori Q8NFZ0.

Family and domain databases

Gene3Di 3.40.50.300. 3 hits.
InterProi IPR014017. DNA_helicase_UvrD-like_C.
IPR000212. DNA_helicase_UvrD/REP.
IPR001810. F-box_dom.
IPR027417. P-loop_NTPase.
IPR014016. UvrD-like_ATP-bd.
[Graphical view ]
PANTHERi PTHR11070. PTHR11070. 1 hit.
Pfami PF12937. F-box-like. 1 hit.
PF00580. UvrD-helicase. 1 hit.
PF13361. UvrD_C. 1 hit.
[Graphical view ]
SMARTi SM00256. FBOX. 1 hit.
[Graphical view ]
SUPFAMi SSF52540. SSF52540. 3 hits.
SSF81383. SSF81383. 1 hit.
PROSITEi PS50181. FBOX. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH SKP1, IDENTIFICATION IN SCF COMPLEX.
  2. Zan Q., Guo J.H., Yu L.
    Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Choriocarcinoma and Testis.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Mammary gland, Testis carcinoma and Tongue.
  4. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain, Pancreas and Testis.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 763-1043 (ISOFORMS 1/2).
    Tissue: Testis.

Entry informationi

Entry nameiFBX18_HUMAN
AccessioniPrimary (citable) accession number: Q8NFZ0
Secondary accession number(s): Q5JVB0
, Q5JVB1, Q7Z4Q6, Q7Z4R0, Q8N1P5, Q8N586, Q96E82, Q96K67, Q96SW7, Q9UFB2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 15, 2004
Last sequence update: March 15, 2004
Last modified: October 29, 2014
This is version 119 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3