Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NFZ0 (FBX18_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 114. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
F-box only protein 18

EC=3.6.4.12
Alternative name(s):
F-box DNA helicase 1
Gene names
Name:FBXO18
Synonyms:FBH1, FBX18
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1043 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

DNA-dependent ATPase. Unwinds double-stranded DNA in a 3' to 5' direction. Ref.1

Probably recognizes and binds to some phosphorylated proteins and promotes their ubiquitination and degradation. Ref.1

Catalytic activity

ATP + H2O = ADP + phosphate.

Subunit structure

Part of a SCF E3 ubiquitin ligase complex consisting of SKP1, CUL1, RBX1 and FBXO18. Interacts with SKP1. Ref.1

Subcellular location

Nucleus Probable.

Sequence similarities

Belongs to the helicase family. UvrD subfamily.

Contains 1 F-box domain.

Sequence caution

The sequence AAM73631.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAB55073.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAB55154.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Biological processUbl conjugation pathway
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   LigandATP-binding
DNA-binding
Nucleotide-binding
   Molecular functionHelicase
Hydrolase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionATP binding

Inferred from electronic annotation. Source: UniProtKB-KW

ATP-dependent DNA helicase activity

Inferred from electronic annotation. Source: InterPro

DNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Binary interactions

With

Entry

#Exp.

IntAct

Notes

SRCP129314EBI-724767,EBI-621482

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8NFZ0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8NFZ0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSYEVTSGCHWTCQVPESCDNGLHCAGPLGHLHRRCQRTSAHLLVFTEHAEM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10431043F-box only protein 18
PRO_0000119901

Regions

Domain138 – 18447F-box

Natural variations

Alternative sequence11M → MSYEVTSGCHWTCQVPESCD NGLHCAGPLGHLHRRCQRTS AHLLVFTEHAEM in isoform 2.
VSP_037942

Experimental info

Sequence conflict2341W → R in BAC04535. Ref.3
Sequence conflict3391Missing in AAP97700. Ref.2
Sequence conflict3391Missing in BAB55154. Ref.3
Sequence conflict4251K → N in AAP97705. Ref.2
Sequence conflict8441N → S in BAC04535. Ref.3
Sequence conflict9841P → L in AAP97700. Ref.2
Sequence conflict9841P → L in BAB55154. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 15, 2004. Version 2.
Checksum: E20EB343E9D05C4D

FASTA1,043117,686
        10         20         30         40         50         60 
MRRFKRKHLT AIDCQHLARS HLAVTQPFGQ RWTNRDPNHG LYPKPRTKRG SRGQGSQRCI 

        70         80         90        100        110        120 
PEFFLAGKQP CTNDMAKSNS VGQDSCQDSE GDMIFPAESS CALPQEGSAG PGSPGSAPPS 

       130        140        150        160        170        180 
RKRSWSSEEE SNQATGTSRW DGVSKKAPRH HLSVPCTRPR EARQEAEDST SRLSAESGET 

       190        200        210        220        230        240 
DQDAGDVGPD PIPDSYYGLL GTLPCQEALS HICSLPSEVL RHVFAFLPVE DLYWNLSLVC 

       250        260        270        280        290        300 
HLWREIISDP LFIPWKKLYH RYLMNEEQAV SKVDGILSNC GIEKESDLCV LNLIRYTATT 

       310        320        330        340        350        360 
KCSPSVDPER VLWSLRDHPL LPEAEACVRQ HLPDLYAAAG GVNIWALVAA VVLLSSSVND 

       370        380        390        400        410        420 
IQRLLFCLRR PSSTVTMPDV TETLYCIAVL LYAMREKGIN ISNRIHYNIF YCLYLQENSC 

       430        440        450        460        470        480 
TQATKVKEEP SVWPGKKTIQ LTHEQQLILN HKMEPLQVVK IMAFAGTGKT STLVKYAEKW 

       490        500        510        520        530        540 
SQSRFLYVTF NKSIAKQAER VFPSNVICKT FHSMAYGHIG RKYQSKKKLN LFKLTPFMVN 

       550        560        570        580        590        600 
SVLAEGKGGF IRAKLVCKTL ENFFASADEE LTIDHVPIWC KNSQGQRVMV EQSEKLNGVL 

       610        620        630        640        650        660 
EASRLWDNMR KLGECTEEAH QMTHDGYLKL WQLSKPSLAS FDAIFVDEAQ DCTPAIMNIV 

       670        680        690        700        710        720 
LSQPCGKIFV GDPHQQIYTF RGAVNALFTV PHTHVFYLTQ SFRFGVEIAY VGATILDVCK 

       730        740        750        760        770        780 
RVRKKTLVGG NHQSGIRGDA KGQVALLSRT NANVFDEAVR VTEGEFPSRI HLIGGIKSFG 

       790        800        810        820        830        840 
LDRIIDIWIL LQPEEERRKQ NLVIKDKFIR RWVHKEGFSG FKRYVTAAED KELEAKIAVV 

       850        860        870        880        890        900 
EKYNIRIPEL VQRIEKCHIE DLDFAEYILG TVHKAKGLEF DTVHVLDDFV KVPCARHNLP 

       910        920        930        940        950        960 
QLPHFRVESF SEDEWNLLYV AVTRAKKRLI MTKSLENILT LAGEYFLQAE LTSNVLKTGV 

       970        980        990       1000       1010       1020 
VRCCVGQCNN AIPVDTVLTM KKLPITYSNR KENKGGYLCH SCAEQRIGPL AFLTASPEQV 

      1030       1040 
RAMERTVENI VLPRHEALLF LVF 

« Hide

Isoform 2 [UniParc].

Checksum: F2A3ED56FBC690B4
Show »

FASTA1,094123,375

References

« Hide 'large scale' references
[1]"The novel human DNA helicase hFBH1 is an F-box protein."
Kim J., Kim J.-H., Lee S.-H., Kim D.-H., Kang H.-Y., Bae S.-H., Pan Z.-Q., Seo Y.-S.
J. Biol. Chem. 277:24530-24537(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH SKP1, IDENTIFICATION IN SCF COMPLEX.
[2]Zan Q., Guo J.H., Yu L.
Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Choriocarcinoma and Testis.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Mammary gland, Testis carcinoma and Tongue.
[4]"The DNA sequence and comparative analysis of human chromosome 10."
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. expand/collapse author list , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain, Pancreas and Testis.
[7]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 763-1043 (ISOFORMS 1/2).
Tissue: Testis.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF380349 mRNA. Translation: AAM73631.1. Different initiation.
AF454502 mRNA. Translation: AAP97700.1.
AF456237 mRNA. Translation: AAP97705.1.
AK027381 mRNA. Translation: BAB55073.1. Different initiation.
AK027496 mRNA. Translation: BAB55154.1. Different initiation.
AK095343 mRNA. Translation: BAC04535.1.
AL137186 Genomic DNA. Translation: CAI41073.1.
AL137186 Genomic DNA. Translation: CAI41074.1.
CH471072 Genomic DNA. Translation: EAW86426.1.
BC012762 mRNA. Translation: AAH12762.2.
BC032674 mRNA. Translation: AAH32674.2.
BC113377 mRNA. Translation: AAI13378.1.
AL133069 mRNA. Translation: CAB61392.1.
PIRT42669.
RefSeqNP_001245381.1. NM_001258452.1.
NP_001245382.1. NM_001258453.1.
NP_116196.3. NM_032807.4.
NP_835363.1. NM_178150.2.
UniGeneHs.498543.

3D structure databases

ProteinModelPortalQ8NFZ0.
SMRQ8NFZ0. Positions 214-247, 439-527, 865-944.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124333. 6 interactions.
IntActQ8NFZ0. 4 interactions.

PTM databases

PhosphoSiteQ8NFZ0.

Polymorphism databases

DMDM45476952.

Proteomic databases

PaxDbQ8NFZ0.
PRIDEQ8NFZ0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000362091; ENSP00000355415; ENSG00000134452. [Q8NFZ0-1]
ENST00000379999; ENSP00000369335; ENSG00000134452. [Q8NFZ0-2]
GeneID84893.
KEGGhsa:84893.
UCSCuc001iir.4. human. [Q8NFZ0-1]
uc001iit.4. human. [Q8NFZ0-2]

Organism-specific databases

CTD84893.
GeneCardsGC10P005931.
HGNCHGNC:13620. FBXO18.
HPAHPA002844.
MIM607222. gene.
neXtProtNX_Q8NFZ0.
PharmGKBPA134948258.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0210.
HOVERGENHBG051568.
InParanoidQ8NFZ0.
KOK10300.
OMAVFPSNVI.
OrthoDBEOG725DGV.
PhylomeDBQ8NFZ0.
TreeFamTF329020.

Gene expression databases

ArrayExpressQ8NFZ0.
BgeeQ8NFZ0.
GenevestigatorQ8NFZ0.

Family and domain databases

Gene3D3.40.50.300. 3 hits.
InterProIPR014017. DNA_helicase_UvrD-like_C.
IPR000212. DNA_helicase_UvrD/REP.
IPR001810. F-box_dom.
IPR027417. P-loop_NTPase.
IPR014016. UvrD-like_ATP-bd.
[Graphical view]
PANTHERPTHR11070. PTHR11070. 1 hit.
PfamPF00580. UvrD-helicase. 1 hit.
PF13361. UvrD_C. 1 hit.
[Graphical view]
SMARTSM00256. FBOX. 1 hit.
[Graphical view]
SUPFAMSSF52540. SSF52540. 3 hits.
SSF81383. SSF81383. 1 hit.
PROSITEPS50181. FBOX. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSFBXO18. human.
GenomeRNAi84893.
NextBio75230.
PROQ8NFZ0.
SOURCESearch...

Entry information

Entry nameFBX18_HUMAN
AccessionPrimary (citable) accession number: Q8NFZ0
Secondary accession number(s): Q5JVB0 expand/collapse secondary AC list , Q5JVB1, Q7Z4Q6, Q7Z4R0, Q8N1P5, Q8N586, Q96E82, Q96K67, Q96SW7, Q9UFB2
Entry history
Integrated into UniProtKB/Swiss-Prot: March 15, 2004
Last sequence update: March 15, 2004
Last modified: April 16, 2014
This is version 114 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 10

Human chromosome 10: entries, gene names and cross-references to MIM