Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Metalloreductase STEAP2

Gene

STEAP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor (By similarity).By similarity

Cofactori

FADBy similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi316 – 3161Iron (heme axial ligand)By similarity
Metal bindingi409 – 4091Iron (heme axial ligand)By similarity

GO - Molecular functioni

GO - Biological processi

  • copper ion import Source: GO_Central
  • endocytosis Source: UniProtKB
  • ferric iron import into cell Source: GO_Central
  • Golgi to plasma membrane transport Source: UniProtKB
  • iron ion homeostasis Source: UniProtKB-KW
  • oxidation-reduction process Source: GO_Central
  • regulated secretory pathway Source: UniProtKB
  • response to hormone Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Oxidoreductase

Keywords - Biological processi

Electron transport, Ion transport, Iron transport, Transport

Keywords - Ligandi

Copper, FAD, Flavoprotein, Iron, Metal-binding, NAD

Enzyme and pathway databases

ReactomeiREACT_25283. Transferrin endocytosis and recycling.

Protein family/group databases

TCDBi9.B.66.1.2. the animal nonclassical protein secretion (nps) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Metalloreductase STEAP2 (EC:1.16.1.-)
Alternative name(s):
Prostate cancer-associated protein 1
Protein up-regulated in metastatic prostate cancer
Short name:
PUMPCn
Six-transmembrane epithelial antigen of prostate 2
SixTransMembrane protein of prostate 1
Gene namesi
Name:STEAP2
Synonyms:PCANAP1, STAMP1
ORF Names:UNQ6507/PRO23203
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:17885. STEAP2.

Subcellular locationi

  • Endosome membrane By similarity; Multi-pass membrane protein By similarity
  • Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei208 – 22821HelicalSequence AnalysisAdd
BLAST
Transmembranei259 – 27921HelicalSequence AnalysisAdd
BLAST
Transmembranei305 – 32521HelicalSequence AnalysisAdd
BLAST
Transmembranei359 – 37921HelicalSequence AnalysisAdd
BLAST
Transmembranei393 – 41321HelicalSequence AnalysisAdd
BLAST
Transmembranei432 – 45221HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  • cytosol Source: UniProtKB
  • early endosome Source: UniProtKB
  • endosome membrane Source: UniProtKB-SubCell
  • integral component of Golgi membrane Source: UniProtKB
  • integral component of plasma membrane Source: GO_Central
  • intracellular membrane-bounded organelle Source: HPA
  • plasma membrane Source: UniProtKB
  • trans-Golgi network transport vesicle Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38473.

Polymorphism and mutation databases

BioMutaiSTEAP2.
DMDMi296452950.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 490490Metalloreductase STEAP2PRO_0000191697Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei3 – 31PhosphoserineBy similarity
Modified residuei9 – 91PhosphoserineBy similarity
Modified residuei12 – 121PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8NFT2.
PaxDbiQ8NFT2.
PeptideAtlasiQ8NFT2.
PRIDEiQ8NFT2.

PTM databases

PhosphoSiteiQ8NFT2.

Expressioni

Tissue specificityi

Expressed at high levels in prostate and at significantly lower levels in heart, brain, kidney, pancreas, and ovary.3 Publications

Gene expression databases

BgeeiQ8NFT2.
CleanExiHS_STEAP2.
ExpressionAtlasiQ8NFT2. baseline and differential.
GenevisibleiQ8NFT2. HS.

Organism-specific databases

HPAiHPA029115.
HPA055603.

Interactioni

Protein-protein interaction databases

BioGridi129285. 1 interaction.
STRINGi9606.ENSP00000287908.

Structurei

3D structure databases

ProteinModelPortaliQ8NFT2.
SMRiQ8NFT2. Positions 33-209.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini259 – 407149Ferric oxidoreductaseAdd
BLAST

Sequence similaritiesi

Belongs to the STEAP family.Curated
Contains 1 ferric oxidoreductase domain.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG2085.
GeneTreeiENSGT00390000008042.
HOGENOMiHOG000234491.
HOVERGENiHBG054379.
InParanoidiQ8NFT2.
KOiK14738.
OMAiFFFASVH.
PhylomeDBiQ8NFT2.
TreeFamiTF332031.

Family and domain databases

Gene3Di3.40.50.720. 1 hit.
InterProiIPR013130. Fe3_Rdtase_TM_dom.
IPR016040. NAD(P)-bd_dom.
IPR028939. ProC_N.
[Graphical view]
PfamiPF03807. F420_oxidored. 1 hit.
PF01794. Ferric_reduct. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NFT2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESISMMGSP KSLSETFLPN GINGIKDARK VTVGVIGSGD FAKSLTIRLI
60 70 80 90 100
RCGYHVVIGS RNPKFASEFF PHVVDVTHHE DALTKTNIIF VAIHREHYTS
110 120 130 140 150
LWDLRHLLVG KILIDVSNNM RINQYPESNA EYLASLFPDS LIVKGFNVVS
160 170 180 190 200
AWALQLGPKD ASRQVYICSN NIQARQQVIE LARQLNFIPI DLGSLSSARE
210 220 230 240 250
IENLPLRLFT LWRGPVVVAI SLATFFFLYS FVRDVIHPYA RNQQSDFYKI
260 270 280 290 300
PIEIVNKTLP IVAITLLSLV YLAGLLAAAY QLYYGTKYRR FPPWLETWLQ
310 320 330 340 350
CRKQLGLLSF FFAMVHVAYS LCLPMRRSER YLFLNMAYQQ VHANIENSWN
360 370 380 390 400
EEEVWRIEMY ISFGIMSLGL LSLLAVTSIP SVSNALNWRE FSFIQSTLGY
410 420 430 440 450
VALLISTFHV LIYGWKRAFE EEYYRFYTPP NFVLALVLPS IVILGKIILF
460 470 480 490
LPCISRKLKR IKKGWEKSQF LEEGMGGTIP HVSPERVTVM
Length:490
Mass (Da):56,056
Last modified:May 18, 2010 - v3
Checksum:iDB12E252DE3F4CAF
GO
Isoform 2 (identifier: Q8NFT2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     445-490: GKIILFLPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM → DLLQLCRYPD

Show »
Length:454
Mass (Da):52,052
Checksum:i1471E787D19E3E21
GO
Isoform 3 (identifier: Q8NFT2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     396-490: STLGYVALLI...HVSPERVTVM → IFCSFADTQTELELEFVFLLTLLL

Note: No experimental confirmation available.
Show »
Length:419
Mass (Da):47,916
Checksum:i97C4B47BD22DA168
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti17 – 171F → V in AAN04080 (PubMed:12429817).Curated
Sequence conflicti211 – 2111L → F in AAG32148 (PubMed:12095985).Curated
Sequence conflicti211 – 2111L → F in AAG32149 (PubMed:12095985).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti17 – 171F → C.5 Publications
Corresponds to variant rs194520 [ dbSNP | Ensembl ].
VAR_060387
Natural varianti40 – 401D → Y.
Corresponds to variant rs17863046 [ dbSNP | Ensembl ].
VAR_060388
Natural varianti214 – 2141G → E.
Corresponds to variant rs13228098 [ dbSNP | Ensembl ].
VAR_057727
Natural varianti456 – 4561R → Q.1 Publication
Corresponds to variant rs194524 [ dbSNP | Ensembl ].
VAR_057728
Natural varianti475 – 4751M → I.4 Publications
Corresponds to variant rs194525 [ dbSNP | Ensembl ].
VAR_060389

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei396 – 49095STLGY…RVTVM → IFCSFADTQTELELEFVFLL TLLL in isoform 3. 1 PublicationVSP_045590Add
BLAST
Alternative sequencei445 – 49046GKIIL…RVTVM → DLLQLCRYPD in isoform 2. 2 PublicationsVSP_030999Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY008444 mRNA. Translation: AAG32148.1.
AY008445 mRNA. Translation: AAG32149.1.
AF455138 mRNA. Translation: AAN04080.1.
AF526382 mRNA. Translation: AAQ08976.1.
AY358267 mRNA. Translation: AAQ88634.1.
AC002064 Genomic DNA. No translation available.
AC004969 Genomic DNA. No translation available.
CH236949 Genomic DNA. Translation: EAL24165.1.
CH471091 Genomic DNA. Translation: EAW76890.1.
CH471091 Genomic DNA. Translation: EAW76894.1.
CCDSiCCDS43612.1. [Q8NFT2-2]
CCDS5615.1. [Q8NFT2-1]
CCDS59064.1. [Q8NFT2-3]
RefSeqiNP_001035755.1. NM_001040665.1. [Q8NFT2-1]
NP_001035756.1. NM_001040666.1. [Q8NFT2-2]
NP_001231873.1. NM_001244944.1. [Q8NFT2-1]
NP_001231875.1. NM_001244946.1. [Q8NFT2-3]
NP_694544.2. NM_152999.3. [Q8NFT2-1]
XP_006715984.1. XM_006715921.2. [Q8NFT2-1]
UniGeneiHs.489051.

Genome annotation databases

EnsembliENST00000287908; ENSP00000287908; ENSG00000157214. [Q8NFT2-1]
ENST00000394621; ENSP00000378119; ENSG00000157214. [Q8NFT2-1]
ENST00000394622; ENSP00000378120; ENSG00000157214. [Q8NFT2-1]
ENST00000394626; ENSP00000378123; ENSG00000157214. [Q8NFT2-2]
ENST00000394629; ENSP00000378125; ENSG00000157214. [Q8NFT2-2]
ENST00000394632; ENSP00000378128; ENSG00000157214. [Q8NFT2-3]
GeneIDi261729.
KEGGihsa:261729.
UCSCiuc003ujy.2. human. [Q8NFT2-1]
uc003ukc.3. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY008444 mRNA. Translation: AAG32148.1.
AY008445 mRNA. Translation: AAG32149.1.
AF455138 mRNA. Translation: AAN04080.1.
AF526382 mRNA. Translation: AAQ08976.1.
AY358267 mRNA. Translation: AAQ88634.1.
AC002064 Genomic DNA. No translation available.
AC004969 Genomic DNA. No translation available.
CH236949 Genomic DNA. Translation: EAL24165.1.
CH471091 Genomic DNA. Translation: EAW76890.1.
CH471091 Genomic DNA. Translation: EAW76894.1.
CCDSiCCDS43612.1. [Q8NFT2-2]
CCDS5615.1. [Q8NFT2-1]
CCDS59064.1. [Q8NFT2-3]
RefSeqiNP_001035755.1. NM_001040665.1. [Q8NFT2-1]
NP_001035756.1. NM_001040666.1. [Q8NFT2-2]
NP_001231873.1. NM_001244944.1. [Q8NFT2-1]
NP_001231875.1. NM_001244946.1. [Q8NFT2-3]
NP_694544.2. NM_152999.3. [Q8NFT2-1]
XP_006715984.1. XM_006715921.2. [Q8NFT2-1]
UniGeneiHs.489051.

3D structure databases

ProteinModelPortaliQ8NFT2.
SMRiQ8NFT2. Positions 33-209.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129285. 1 interaction.
STRINGi9606.ENSP00000287908.

Protein family/group databases

TCDBi9.B.66.1.2. the animal nonclassical protein secretion (nps) family.

PTM databases

PhosphoSiteiQ8NFT2.

Polymorphism and mutation databases

BioMutaiSTEAP2.
DMDMi296452950.

Proteomic databases

MaxQBiQ8NFT2.
PaxDbiQ8NFT2.
PeptideAtlasiQ8NFT2.
PRIDEiQ8NFT2.

Protocols and materials databases

DNASUi261729.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000287908; ENSP00000287908; ENSG00000157214. [Q8NFT2-1]
ENST00000394621; ENSP00000378119; ENSG00000157214. [Q8NFT2-1]
ENST00000394622; ENSP00000378120; ENSG00000157214. [Q8NFT2-1]
ENST00000394626; ENSP00000378123; ENSG00000157214. [Q8NFT2-2]
ENST00000394629; ENSP00000378125; ENSG00000157214. [Q8NFT2-2]
ENST00000394632; ENSP00000378128; ENSG00000157214. [Q8NFT2-3]
GeneIDi261729.
KEGGihsa:261729.
UCSCiuc003ujy.2. human. [Q8NFT2-1]
uc003ukc.3. human.

Organism-specific databases

CTDi261729.
GeneCardsiGC07P089796.
HGNCiHGNC:17885. STEAP2.
HPAiHPA029115.
HPA055603.
MIMi605094. gene.
neXtProtiNX_Q8NFT2.
PharmGKBiPA38473.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG2085.
GeneTreeiENSGT00390000008042.
HOGENOMiHOG000234491.
HOVERGENiHBG054379.
InParanoidiQ8NFT2.
KOiK14738.
OMAiFFFASVH.
PhylomeDBiQ8NFT2.
TreeFamiTF332031.

Enzyme and pathway databases

ReactomeiREACT_25283. Transferrin endocytosis and recycling.

Miscellaneous databases

ChiTaRSiSTEAP2. human.
GeneWikiiSTEAP2.
GenomeRNAii261729.
NextBioi93228.
PROiQ8NFT2.
SOURCEiSearch...

Gene expression databases

BgeeiQ8NFT2.
CleanExiHS_STEAP2.
ExpressionAtlasiQ8NFT2. baseline and differential.
GenevisibleiQ8NFT2. HS.

Family and domain databases

Gene3Di3.40.50.720. 1 hit.
InterProiIPR013130. Fe3_Rdtase_TM_dom.
IPR016040. NAD(P)-bd_dom.
IPR028939. ProC_N.
[Graphical view]
PfamiPF03807. F420_oxidored. 1 hit.
PF01794. Ferric_reduct. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular cloning and characterization of STAMP1, a highly prostate specific six-trans-membrane protein that is overexpressed in prostate cancer."
    Korkmaz K.S., Elbi C.C., Korkmaz C.G., Loda M., Hager G.L., Saatcioglu F.
    J. Biol. Chem. 277:36689-36696(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), TISSUE SPECIFICITY, VARIANTS CYS-17 AND ILE-475.
    Tissue: Prostate.
  2. "Cloning and characterization of a novel six-transmembrane protein STEAP2, expressed in normal and malignant prostate."
    Porkka K.P., Helenius M.A., Visakorpi T.
    Lab. Invest. 82:1573-1582(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, VARIANTS CYS-17; GLN-456 AND ILE-475.
    Tissue: Prostate.
  3. "Bioinformatics identification and clinical validation of tumor antigens by analysis of EST and tissue microarray data."
    Zhang Z., Eberhard D.A., Polakis P., Grimaldi C., Frantz G.D., Hillan K.J., Wood W.I.
    Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT CYS-17.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT CYS-17.
  5. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ILE-475.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ILE-475.
  8. Cited for: TISSUE SPECIFICITY.
  9. Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-17, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiSTEA2_HUMAN
AccessioniPrimary (citable) accession number: Q8NFT2
Secondary accession number(s): A4D1F1
, G5E9C6, Q6UXN6, Q6YPB1, Q8IUE7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: May 18, 2010
Last modified: June 24, 2015
This is version 105 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.