Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NFT2 (STEA2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Metalloreductase STEAP2

EC=1.16.1.-
Alternative name(s):
Prostate cancer-associated protein 1
Protein up-regulated in metastatic prostate cancer
Short name=PUMPCn
Six-transmembrane epithelial antigen of prostate 2
SixTransMembrane protein of prostate 1
Gene names
Name:STEAP2
Synonyms:PCANAP1, STAMP1
ORF Names:UNQ6507/PRO23203
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length490 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor By similarity.

Cofactor

FAD By similarity.

Subcellular location

Endosome membrane; Multi-pass membrane protein By similarity. Cell membrane; Multi-pass membrane protein Ref.2.

Tissue specificity

Expressed at high levels in prostate and at significantly lower levels in heart, brain, kidney, pancreas, and ovary. Ref.1 Ref.2 Ref.8

Sequence similarities

Belongs to the STEAP family.

Contains 1 ferric oxidoreductase domain.

Ontologies

Keywords
   Biological processElectron transport
Ion transport
Iron transport
Transport
   Cellular componentCell membrane
Endosome
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   LigandCopper
FAD
Flavoprotein
Iron
Metal-binding
NAD
   Molecular functionOxidoreductase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processGolgi to plasma membrane transport

Inferred from direct assay Ref.1. Source: UniProtKB

endocytosis

Inferred from direct assay Ref.1. Source: UniProtKB

ion transport

Inferred from electronic annotation. Source: UniProtKB-KW

iron ion homeostasis

Inferred from electronic annotation. Source: UniProtKB-KW

regulated secretory pathway

Inferred from direct assay Ref.1. Source: UniProtKB

response to hormone

Inferred from direct assay Ref.1. Source: UniProtKB

   Cellular_componentcytosol

Inferred from direct assay Ref.1. Source: UniProtKB

early endosome

Inferred from direct assay Ref.1. Source: UniProtKB

endosome membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

integral component of Golgi membrane

Inferred from direct assay Ref.1. Source: UniProtKB

intracellular membrane-bounded organelle

Inferred from direct assay. Source: HPA

plasma membrane

Inferred from direct assay Ref.1. Source: UniProtKB

trans-Golgi network transport vesicle

Inferred from direct assay Ref.1. Source: UniProtKB

   Molecular_functionmetal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

oxidoreductase activity

Inferred from electronic annotation. Source: UniProtKB-KW

transporter activity

Inferred from direct assay Ref.1. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8NFT2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8NFT2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     445-490: GKIILFLPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM → DLLQLCRYPD
Isoform 3 (identifier: Q8NFT2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     396-490: STLGYVALLI...HVSPERVTVM → IFCSFADTQTELELEFVFLLTLLL
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 490490Metalloreductase STEAP2
PRO_0000191697

Regions

Transmembrane208 – 22821Helical; Potential
Transmembrane259 – 27921Helical; Potential
Transmembrane305 – 32521Helical; Potential
Transmembrane359 – 37921Helical; Potential
Transmembrane393 – 41321Helical; Potential
Transmembrane432 – 45221Helical; Potential
Domain259 – 407149Ferric oxidoreductase

Sites

Metal binding3161Iron (heme axial ligand) By similarity
Metal binding4091Iron (heme axial ligand) By similarity

Natural variations

Alternative sequence396 – 49095STLGY…RVTVM → IFCSFADTQTELELEFVFLL TLLL in isoform 3.
VSP_045590
Alternative sequence445 – 49046GKIIL…RVTVM → DLLQLCRYPD in isoform 2.
VSP_030999
Natural variant171F → C. Ref.1 Ref.2 Ref.3 Ref.4 Ref.9
Corresponds to variant rs194520 [ dbSNP | Ensembl ].
VAR_060387
Natural variant401D → Y.
Corresponds to variant rs17863046 [ dbSNP | Ensembl ].
VAR_060388
Natural variant2141G → E.
Corresponds to variant rs13228098 [ dbSNP | Ensembl ].
VAR_057727
Natural variant4561R → Q. Ref.2
Corresponds to variant rs194524 [ dbSNP | Ensembl ].
VAR_057728
Natural variant4751M → I. Ref.1 Ref.2 Ref.6 Ref.7
Corresponds to variant rs194525 [ dbSNP | Ensembl ].
VAR_060389

Experimental info

Sequence conflict171F → V in AAN04080. Ref.2
Sequence conflict2111L → F in AAG32148. Ref.1
Sequence conflict2111L → F in AAG32149. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 18, 2010. Version 3.
Checksum: DB12E252DE3F4CAF

FASTA49056,056
        10         20         30         40         50         60 
MESISMMGSP KSLSETFLPN GINGIKDARK VTVGVIGSGD FAKSLTIRLI RCGYHVVIGS 

        70         80         90        100        110        120 
RNPKFASEFF PHVVDVTHHE DALTKTNIIF VAIHREHYTS LWDLRHLLVG KILIDVSNNM 

       130        140        150        160        170        180 
RINQYPESNA EYLASLFPDS LIVKGFNVVS AWALQLGPKD ASRQVYICSN NIQARQQVIE 

       190        200        210        220        230        240 
LARQLNFIPI DLGSLSSARE IENLPLRLFT LWRGPVVVAI SLATFFFLYS FVRDVIHPYA 

       250        260        270        280        290        300 
RNQQSDFYKI PIEIVNKTLP IVAITLLSLV YLAGLLAAAY QLYYGTKYRR FPPWLETWLQ 

       310        320        330        340        350        360 
CRKQLGLLSF FFAMVHVAYS LCLPMRRSER YLFLNMAYQQ VHANIENSWN EEEVWRIEMY 

       370        380        390        400        410        420 
ISFGIMSLGL LSLLAVTSIP SVSNALNWRE FSFIQSTLGY VALLISTFHV LIYGWKRAFE 

       430        440        450        460        470        480 
EEYYRFYTPP NFVLALVLPS IVILGKIILF LPCISRKLKR IKKGWEKSQF LEEGMGGTIP 

       490 
HVSPERVTVM 

« Hide

Isoform 2 [UniParc].

Checksum: 1471E787D19E3E21
Show »

FASTA45452,052
Isoform 3 [UniParc].

Checksum: 97C4B47BD22DA168
Show »

FASTA41947,916

References

« Hide 'large scale' references
[1]"Molecular cloning and characterization of STAMP1, a highly prostate specific six-trans-membrane protein that is overexpressed in prostate cancer."
Korkmaz K.S., Elbi C.C., Korkmaz C.G., Loda M., Hager G.L., Saatcioglu F.
J. Biol. Chem. 277:36689-36696(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), TISSUE SPECIFICITY, VARIANTS CYS-17 AND ILE-475.
Tissue: Prostate.
[2]"Cloning and characterization of a novel six-transmembrane protein STEAP2, expressed in normal and malignant prostate."
Porkka K.P., Helenius M.A., Visakorpi T.
Lab. Invest. 82:1573-1582(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, VARIANTS CYS-17; GLN-456 AND ILE-475.
Tissue: Prostate.
[3]"Bioinformatics identification and clinical validation of tumor antigens by analysis of EST and tissue microarray data."
Zhang Z., Eberhard D.A., Polakis P., Grimaldi C., Frantz G.D., Hillan K.J., Wood W.I.
Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT CYS-17.
[4]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT CYS-17.
[5]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"Human chromosome 7: DNA sequence and biology."
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. expand/collapse author list , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ILE-475.
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ILE-475.
[8]"The Steap proteins are metalloreductases."
Ohgami R.S., Campagna D.R., McDonald A., Fleming M.D.
Blood 108:1388-1394(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[9]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-17, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY008444 mRNA. Translation: AAG32148.1.
AY008445 mRNA. Translation: AAG32149.1.
AF455138 mRNA. Translation: AAN04080.1.
AF526382 mRNA. Translation: AAQ08976.1.
AY358267 mRNA. Translation: AAQ88634.1.
AC002064 Genomic DNA. No translation available.
AC004969 Genomic DNA. No translation available.
CH236949 Genomic DNA. Translation: EAL24165.1.
CH471091 Genomic DNA. Translation: EAW76890.1.
CH471091 Genomic DNA. Translation: EAW76894.1.
CCDSCCDS43612.1. [Q8NFT2-2]
CCDS5615.1. [Q8NFT2-1]
CCDS59064.1. [Q8NFT2-3]
RefSeqNP_001035755.1. NM_001040665.1. [Q8NFT2-1]
NP_001035756.1. NM_001040666.1. [Q8NFT2-2]
NP_001231873.1. NM_001244944.1. [Q8NFT2-1]
NP_001231875.1. NM_001244946.1. [Q8NFT2-3]
NP_694544.2. NM_152999.3. [Q8NFT2-1]
XP_006715984.1. XM_006715921.1. [Q8NFT2-1]
XP_006715985.1. XM_006715922.1. [Q8NFT2-1]
UniGeneHs.489051.

3D structure databases

ProteinModelPortalQ8NFT2.
SMRQ8NFT2. Positions 33-209.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid129285. 1 interaction.
STRING9606.ENSP00000287908.

Protein family/group databases

TCDB9.B.66.1.2. the animal nonclassical protein secretion (nps) family.

PTM databases

PhosphoSiteQ8NFT2.

Polymorphism databases

DMDM296452950.

Proteomic databases

MaxQBQ8NFT2.
PaxDbQ8NFT2.
PeptideAtlasQ8NFT2.
PRIDEQ8NFT2.

Protocols and materials databases

DNASU261729.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000287908; ENSP00000287908; ENSG00000157214. [Q8NFT2-1]
ENST00000394621; ENSP00000378119; ENSG00000157214. [Q8NFT2-1]
ENST00000394622; ENSP00000378120; ENSG00000157214. [Q8NFT2-1]
ENST00000394626; ENSP00000378123; ENSG00000157214. [Q8NFT2-2]
ENST00000394629; ENSP00000378125; ENSG00000157214. [Q8NFT2-2]
ENST00000394632; ENSP00000378128; ENSG00000157214. [Q8NFT2-3]
GeneID261729.
KEGGhsa:261729.
UCSCuc003ujy.2. human. [Q8NFT2-1]
uc003ukc.3. human.

Organism-specific databases

CTD261729.
GeneCardsGC07P089796.
HGNCHGNC:17885. STEAP2.
HPAHPA029115.
HPA055603.
MIM605094. gene.
neXtProtNX_Q8NFT2.
PharmGKBPA38473.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2085.
HOGENOMHOG000234491.
HOVERGENHBG054379.
InParanoidQ8NFT2.
KOK14738.
OMAFFFASVH.
PhylomeDBQ8NFT2.
TreeFamTF332031.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressQ8NFT2.
BgeeQ8NFT2.
CleanExHS_STEAP2.
GenevestigatorQ8NFT2.

Family and domain databases

Gene3D3.40.50.720. 1 hit.
InterProIPR013130. Fe3_Rdtase_TM_dom.
IPR016040. NAD(P)-bd_dom.
IPR028939. ProC_N.
[Graphical view]
PfamPF03807. F420_oxidored. 1 hit.
PF01794. Ferric_reduct. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSTEAP2. human.
GeneWikiSTEAP2.
GenomeRNAi261729.
NextBio93228.
PROQ8NFT2.
SOURCESearch...

Entry information

Entry nameSTEA2_HUMAN
AccessionPrimary (citable) accession number: Q8NFT2
Secondary accession number(s): A4D1F1 expand/collapse secondary AC list , G5E9C6, Q6UXN6, Q6YPB1, Q8IUE7
Entry history
Integrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: May 18, 2010
Last modified: July 9, 2014
This is version 97 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM