Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NFT2

- STEA2_HUMAN

UniProt

Q8NFT2 - STEA2_HUMAN

Protein

Metalloreductase STEAP2

Gene

STEAP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 99 (01 Oct 2014)
      Sequence version 3 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor By similarity.By similarity

    Cofactori

    FAD.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi316 – 3161Iron (heme axial ligand)By similarity
    Metal bindingi409 – 4091Iron (heme axial ligand)By similarity

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. oxidoreductase activity Source: UniProtKB-KW
    3. transporter activity Source: UniProtKB

    GO - Biological processi

    1. endocytosis Source: UniProtKB
    2. Golgi to plasma membrane transport Source: UniProtKB
    3. ion transport Source: UniProtKB-KW
    4. iron ion homeostasis Source: UniProtKB-KW
    5. regulated secretory pathway Source: UniProtKB
    6. response to hormone Source: UniProtKB

    Keywords - Molecular functioni

    Oxidoreductase

    Keywords - Biological processi

    Electron transport, Ion transport, Iron transport, Transport

    Keywords - Ligandi

    Copper, FAD, Flavoprotein, Iron, Metal-binding, NAD

    Enzyme and pathway databases

    ReactomeiREACT_25283. Transferrin endocytosis and recycling.

    Protein family/group databases

    TCDBi9.B.66.1.2. the animal nonclassical protein secretion (nps) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Metalloreductase STEAP2 (EC:1.16.1.-)
    Alternative name(s):
    Prostate cancer-associated protein 1
    Protein up-regulated in metastatic prostate cancer
    Short name:
    PUMPCn
    Six-transmembrane epithelial antigen of prostate 2
    SixTransMembrane protein of prostate 1
    Gene namesi
    Name:STEAP2
    Synonyms:PCANAP1, STAMP1
    ORF Names:UNQ6507/PRO23203
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:17885. STEAP2.

    Subcellular locationi

    Endosome membrane By similarity; Multi-pass membrane protein By similarity. Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. cytosol Source: UniProtKB
    2. early endosome Source: UniProtKB
    3. endosome membrane Source: UniProtKB-SubCell
    4. integral component of Golgi membrane Source: UniProtKB
    5. intracellular membrane-bounded organelle Source: HPA
    6. plasma membrane Source: UniProtKB
    7. trans-Golgi network transport vesicle Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Endosome, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38473.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 490490Metalloreductase STEAP2PRO_0000191697Add
    BLAST

    Proteomic databases

    MaxQBiQ8NFT2.
    PaxDbiQ8NFT2.
    PeptideAtlasiQ8NFT2.
    PRIDEiQ8NFT2.

    PTM databases

    PhosphoSiteiQ8NFT2.

    Expressioni

    Tissue specificityi

    Expressed at high levels in prostate and at significantly lower levels in heart, brain, kidney, pancreas, and ovary.3 Publications

    Gene expression databases

    ArrayExpressiQ8NFT2.
    BgeeiQ8NFT2.
    CleanExiHS_STEAP2.
    GenevestigatoriQ8NFT2.

    Organism-specific databases

    HPAiHPA029115.
    HPA055603.

    Interactioni

    Protein-protein interaction databases

    BioGridi129285. 1 interaction.
    STRINGi9606.ENSP00000287908.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NFT2.
    SMRiQ8NFT2. Positions 33-209.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei208 – 22821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei259 – 27921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei305 – 32521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei359 – 37921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei393 – 41321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei432 – 45221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini259 – 407149Ferric oxidoreductaseAdd
    BLAST

    Sequence similaritiesi

    Belongs to the STEAP family.Curated
    Contains 1 ferric oxidoreductase domain.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG2085.
    HOGENOMiHOG000234491.
    HOVERGENiHBG054379.
    InParanoidiQ8NFT2.
    KOiK14738.
    OMAiFFFASVH.
    PhylomeDBiQ8NFT2.
    TreeFamiTF332031.

    Family and domain databases

    Gene3Di3.40.50.720. 1 hit.
    InterProiIPR013130. Fe3_Rdtase_TM_dom.
    IPR016040. NAD(P)-bd_dom.
    IPR028939. ProC_N.
    [Graphical view]
    PfamiPF03807. F420_oxidored. 1 hit.
    PF01794. Ferric_reduct. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NFT2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MESISMMGSP KSLSETFLPN GINGIKDARK VTVGVIGSGD FAKSLTIRLI    50
    RCGYHVVIGS RNPKFASEFF PHVVDVTHHE DALTKTNIIF VAIHREHYTS 100
    LWDLRHLLVG KILIDVSNNM RINQYPESNA EYLASLFPDS LIVKGFNVVS 150
    AWALQLGPKD ASRQVYICSN NIQARQQVIE LARQLNFIPI DLGSLSSARE 200
    IENLPLRLFT LWRGPVVVAI SLATFFFLYS FVRDVIHPYA RNQQSDFYKI 250
    PIEIVNKTLP IVAITLLSLV YLAGLLAAAY QLYYGTKYRR FPPWLETWLQ 300
    CRKQLGLLSF FFAMVHVAYS LCLPMRRSER YLFLNMAYQQ VHANIENSWN 350
    EEEVWRIEMY ISFGIMSLGL LSLLAVTSIP SVSNALNWRE FSFIQSTLGY 400
    VALLISTFHV LIYGWKRAFE EEYYRFYTPP NFVLALVLPS IVILGKIILF 450
    LPCISRKLKR IKKGWEKSQF LEEGMGGTIP HVSPERVTVM 490
    Length:490
    Mass (Da):56,056
    Last modified:May 18, 2010 - v3
    Checksum:iDB12E252DE3F4CAF
    GO
    Isoform 2 (identifier: Q8NFT2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         445-490: GKIILFLPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM → DLLQLCRYPD

    Show »
    Length:454
    Mass (Da):52,052
    Checksum:i1471E787D19E3E21
    GO
    Isoform 3 (identifier: Q8NFT2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         396-490: STLGYVALLI...HVSPERVTVM → IFCSFADTQTELELEFVFLLTLLL

    Note: No experimental confirmation available.

    Show »
    Length:419
    Mass (Da):47,916
    Checksum:i97C4B47BD22DA168
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti17 – 171F → V in AAN04080. (PubMed:12429817)Curated
    Sequence conflicti211 – 2111L → F in AAG32148. (PubMed:12095985)Curated
    Sequence conflicti211 – 2111L → F in AAG32149. (PubMed:12095985)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti17 – 171F → C.5 Publications
    Corresponds to variant rs194520 [ dbSNP | Ensembl ].
    VAR_060387
    Natural varianti40 – 401D → Y.
    Corresponds to variant rs17863046 [ dbSNP | Ensembl ].
    VAR_060388
    Natural varianti214 – 2141G → E.
    Corresponds to variant rs13228098 [ dbSNP | Ensembl ].
    VAR_057727
    Natural varianti456 – 4561R → Q.1 Publication
    Corresponds to variant rs194524 [ dbSNP | Ensembl ].
    VAR_057728
    Natural varianti475 – 4751M → I.4 Publications
    Corresponds to variant rs194525 [ dbSNP | Ensembl ].
    VAR_060389

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei396 – 49095STLGY…RVTVM → IFCSFADTQTELELEFVFLL TLLL in isoform 3. 1 PublicationVSP_045590Add
    BLAST
    Alternative sequencei445 – 49046GKIIL…RVTVM → DLLQLCRYPD in isoform 2. 2 PublicationsVSP_030999Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY008444 mRNA. Translation: AAG32148.1.
    AY008445 mRNA. Translation: AAG32149.1.
    AF455138 mRNA. Translation: AAN04080.1.
    AF526382 mRNA. Translation: AAQ08976.1.
    AY358267 mRNA. Translation: AAQ88634.1.
    AC002064 Genomic DNA. No translation available.
    AC004969 Genomic DNA. No translation available.
    CH236949 Genomic DNA. Translation: EAL24165.1.
    CH471091 Genomic DNA. Translation: EAW76890.1.
    CH471091 Genomic DNA. Translation: EAW76894.1.
    CCDSiCCDS43612.1. [Q8NFT2-2]
    CCDS5615.1. [Q8NFT2-1]
    CCDS59064.1. [Q8NFT2-3]
    RefSeqiNP_001035755.1. NM_001040665.1. [Q8NFT2-1]
    NP_001035756.1. NM_001040666.1. [Q8NFT2-2]
    NP_001231873.1. NM_001244944.1. [Q8NFT2-1]
    NP_001231875.1. NM_001244946.1. [Q8NFT2-3]
    NP_694544.2. NM_152999.3. [Q8NFT2-1]
    XP_006715984.1. XM_006715921.1. [Q8NFT2-1]
    XP_006715985.1. XM_006715922.1. [Q8NFT2-1]
    UniGeneiHs.489051.

    Genome annotation databases

    EnsembliENST00000287908; ENSP00000287908; ENSG00000157214. [Q8NFT2-1]
    ENST00000394621; ENSP00000378119; ENSG00000157214. [Q8NFT2-1]
    ENST00000394622; ENSP00000378120; ENSG00000157214. [Q8NFT2-1]
    ENST00000394626; ENSP00000378123; ENSG00000157214. [Q8NFT2-2]
    ENST00000394629; ENSP00000378125; ENSG00000157214. [Q8NFT2-2]
    ENST00000394632; ENSP00000378128; ENSG00000157214. [Q8NFT2-3]
    GeneIDi261729.
    KEGGihsa:261729.
    UCSCiuc003ujy.2. human. [Q8NFT2-1]
    uc003ukc.3. human.

    Polymorphism databases

    DMDMi296452950.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY008444 mRNA. Translation: AAG32148.1 .
    AY008445 mRNA. Translation: AAG32149.1 .
    AF455138 mRNA. Translation: AAN04080.1 .
    AF526382 mRNA. Translation: AAQ08976.1 .
    AY358267 mRNA. Translation: AAQ88634.1 .
    AC002064 Genomic DNA. No translation available.
    AC004969 Genomic DNA. No translation available.
    CH236949 Genomic DNA. Translation: EAL24165.1 .
    CH471091 Genomic DNA. Translation: EAW76890.1 .
    CH471091 Genomic DNA. Translation: EAW76894.1 .
    CCDSi CCDS43612.1. [Q8NFT2-2 ]
    CCDS5615.1. [Q8NFT2-1 ]
    CCDS59064.1. [Q8NFT2-3 ]
    RefSeqi NP_001035755.1. NM_001040665.1. [Q8NFT2-1 ]
    NP_001035756.1. NM_001040666.1. [Q8NFT2-2 ]
    NP_001231873.1. NM_001244944.1. [Q8NFT2-1 ]
    NP_001231875.1. NM_001244946.1. [Q8NFT2-3 ]
    NP_694544.2. NM_152999.3. [Q8NFT2-1 ]
    XP_006715984.1. XM_006715921.1. [Q8NFT2-1 ]
    XP_006715985.1. XM_006715922.1. [Q8NFT2-1 ]
    UniGenei Hs.489051.

    3D structure databases

    ProteinModelPortali Q8NFT2.
    SMRi Q8NFT2. Positions 33-209.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 129285. 1 interaction.
    STRINGi 9606.ENSP00000287908.

    Protein family/group databases

    TCDBi 9.B.66.1.2. the animal nonclassical protein secretion (nps) family.

    PTM databases

    PhosphoSitei Q8NFT2.

    Polymorphism databases

    DMDMi 296452950.

    Proteomic databases

    MaxQBi Q8NFT2.
    PaxDbi Q8NFT2.
    PeptideAtlasi Q8NFT2.
    PRIDEi Q8NFT2.

    Protocols and materials databases

    DNASUi 261729.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000287908 ; ENSP00000287908 ; ENSG00000157214 . [Q8NFT2-1 ]
    ENST00000394621 ; ENSP00000378119 ; ENSG00000157214 . [Q8NFT2-1 ]
    ENST00000394622 ; ENSP00000378120 ; ENSG00000157214 . [Q8NFT2-1 ]
    ENST00000394626 ; ENSP00000378123 ; ENSG00000157214 . [Q8NFT2-2 ]
    ENST00000394629 ; ENSP00000378125 ; ENSG00000157214 . [Q8NFT2-2 ]
    ENST00000394632 ; ENSP00000378128 ; ENSG00000157214 . [Q8NFT2-3 ]
    GeneIDi 261729.
    KEGGi hsa:261729.
    UCSCi uc003ujy.2. human. [Q8NFT2-1 ]
    uc003ukc.3. human.

    Organism-specific databases

    CTDi 261729.
    GeneCardsi GC07P089796.
    HGNCi HGNC:17885. STEAP2.
    HPAi HPA029115.
    HPA055603.
    MIMi 605094. gene.
    neXtProti NX_Q8NFT2.
    PharmGKBi PA38473.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2085.
    HOGENOMi HOG000234491.
    HOVERGENi HBG054379.
    InParanoidi Q8NFT2.
    KOi K14738.
    OMAi FFFASVH.
    PhylomeDBi Q8NFT2.
    TreeFami TF332031.

    Enzyme and pathway databases

    Reactomei REACT_25283. Transferrin endocytosis and recycling.

    Miscellaneous databases

    ChiTaRSi STEAP2. human.
    GeneWikii STEAP2.
    GenomeRNAii 261729.
    NextBioi 93228.
    PROi Q8NFT2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8NFT2.
    Bgeei Q8NFT2.
    CleanExi HS_STEAP2.
    Genevestigatori Q8NFT2.

    Family and domain databases

    Gene3Di 3.40.50.720. 1 hit.
    InterProi IPR013130. Fe3_Rdtase_TM_dom.
    IPR016040. NAD(P)-bd_dom.
    IPR028939. ProC_N.
    [Graphical view ]
    Pfami PF03807. F420_oxidored. 1 hit.
    PF01794. Ferric_reduct. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular cloning and characterization of STAMP1, a highly prostate specific six-trans-membrane protein that is overexpressed in prostate cancer."
      Korkmaz K.S., Elbi C.C., Korkmaz C.G., Loda M., Hager G.L., Saatcioglu F.
      J. Biol. Chem. 277:36689-36696(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), TISSUE SPECIFICITY, VARIANTS CYS-17 AND ILE-475.
      Tissue: Prostate.
    2. "Cloning and characterization of a novel six-transmembrane protein STEAP2, expressed in normal and malignant prostate."
      Porkka K.P., Helenius M.A., Visakorpi T.
      Lab. Invest. 82:1573-1582(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, VARIANTS CYS-17; GLN-456 AND ILE-475.
      Tissue: Prostate.
    3. "Bioinformatics identification and clinical validation of tumor antigens by analysis of EST and tissue microarray data."
      Zhang Z., Eberhard D.A., Polakis P., Grimaldi C., Frantz G.D., Hillan K.J., Wood W.I.
      Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT CYS-17.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT CYS-17.
    5. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "Human chromosome 7: DNA sequence and biology."
      Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
      , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
      Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ILE-475.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ILE-475.
    8. Cited for: TISSUE SPECIFICITY.
    9. Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-17, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiSTEA2_HUMAN
    AccessioniPrimary (citable) accession number: Q8NFT2
    Secondary accession number(s): A4D1F1
    , G5E9C6, Q6UXN6, Q6YPB1, Q8IUE7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 10, 2005
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 99 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3