Q8NFT2 (STEA2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Metalloreductase STEAP2 EC=1.16.1.- Alternative name(s): Prostate cancer-associated protein 1 Protein up-regulated in metastatic prostate cancer Short name=PUMPCn Six-transmembrane epithelial antigen of prostate 2 SixTransMembrane protein of prostate 1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 490 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor By similarity. |
| Cofactor | FAD By similarity. |
| Subcellular location | Endosome membrane; Multi-pass membrane protein By similarity. Cell membrane; Multi-pass membrane protein Ref.2. |
| Tissue specificity | Expressed at high levels in prostate and at significantly lower levels in heart, brain, kidney, pancreas, and ovary. Ref.1 Ref.2 Ref.8 |
| Sequence similarities | Belongs to the STEAP family. Contains 1 ferric oxidoreductase domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NFT2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NFT2-2) The sequence of this isoform differs from the canonical sequence as follows: 445-490: GKIILFLPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM → DLLQLCRYPD | ||||||
| Isoform 3 (identifier: Q8NFT2-3) The sequence of this isoform differs from the canonical sequence as follows: 396-490: STLGYVALLI...HVSPERVTVM → IFCSFADTQTELELEFVFLLTLLL | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 490 | 490 | Metalloreductase STEAP2 | PRO_0000191697 | |||||
Regions | |||||||||
| Transmembrane | 208 – 228 | 21 | Helical; Potential | ||||||
| Transmembrane | 259 – 279 | 21 | Helical; Potential | ||||||
| Transmembrane | 305 – 325 | 21 | Helical; Potential | ||||||
| Transmembrane | 359 – 379 | 21 | Helical; Potential | ||||||
| Transmembrane | 393 – 413 | 21 | Helical; Potential | ||||||
| Transmembrane | 432 – 452 | 21 | Helical; Potential | ||||||
| Domain | 259 – 407 | 149 | Ferric oxidoreductase | ||||||
Sites | |||||||||
| Metal binding | 316 | 1 | Iron (heme axial ligand) By similarity | ||||||
| Metal binding | 409 | 1 | Iron (heme axial ligand) By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 396 – 490 | 95 | STLGY…RVTVM → IFCSFADTQTELELEFVFLL TLLL in isoform 3. | VSP_045590 | |||||
| Alternative sequence | 445 – 490 | 46 | GKIIL…RVTVM → DLLQLCRYPD in isoform 2. | VSP_030999 | |||||
| Natural variant | 17 | 1 | F → C. Ref.1 Ref.2 Ref.3 Ref.4 Ref.9 Corresponds to variant rs194520 [ dbSNP | Ensembl ]. | VAR_060387 | |||||
| Natural variant | 40 | 1 | D → Y. Corresponds to variant rs17863046 [ dbSNP | Ensembl ]. | VAR_060388 | |||||
| Natural variant | 214 | 1 | G → E. Corresponds to variant rs13228098 [ dbSNP | Ensembl ]. | VAR_057727 | |||||
| Natural variant | 456 | 1 | R → Q. Ref.2 Corresponds to variant rs194524 [ dbSNP | Ensembl ]. | VAR_057728 | |||||
| Natural variant | 475 | 1 | M → I. Ref.1 Ref.2 Ref.6 Ref.7 Corresponds to variant rs194525 [ dbSNP | Ensembl ]. | VAR_060389 | |||||
Experimental info | |||||||||
| Sequence conflict | 17 | 1 | F → V in AAN04080. Ref.2 | ||||||
| Sequence conflict | 211 | 1 | L → F in AAG32148. Ref.1 | ||||||
| Sequence conflict | 211 | 1 | L → F in AAG32149. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of STAMP1, a highly prostate specific six-trans-membrane protein that is overexpressed in prostate cancer." Korkmaz K.S., Elbi C.C., Korkmaz C.G., Loda M., Hager G.L., Saatcioglu F. J. Biol. Chem. 277:36689-36696(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), TISSUE SPECIFICITY, VARIANTS CYS-17 AND ILE-475. Tissue: Prostate. |
| [2] | "Cloning and characterization of a novel six-transmembrane protein STEAP2, expressed in normal and malignant prostate." Porkka K.P., Helenius M.A., Visakorpi T. Lab. Invest. 82:1573-1582(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, VARIANTS CYS-17; GLN-456 AND ILE-475. Tissue: Prostate. |
| [3] | "Bioinformatics identification and clinical validation of tumor antigens by analysis of EST and tissue microarray data." Zhang Z., Eberhard D.A., Polakis P., Grimaldi C., Frantz G.D., Hillan K.J., Wood W.I. Submitted (JUL-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT CYS-17. |
| [4] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT CYS-17. |
| [5] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "Human chromosome 7: DNA sequence and biology." Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. Tsui L.-C.Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ILE-475. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ILE-475. |
| [8] | "The Steap proteins are metalloreductases." Ohgami R.S., Campagna D.R., McDonald A., Fleming M.D. Blood 108:1388-1394(2006) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] CYS-17, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY008444 mRNA. Translation: AAG32148.1. AY008445 mRNA. Translation: AAG32149.1. AF455138 mRNA. Translation: AAN04080.1. AF526382 mRNA. Translation: AAQ08976.1. AY358267 mRNA. Translation: AAQ88634.1. AC002064 Genomic DNA. No translation available. AC004969 Genomic DNA. No translation available. CH236949 Genomic DNA. Translation: EAL24165.1. CH471091 Genomic DNA. Translation: EAW76890.1. CH471091 Genomic DNA. Translation: EAW76894.1. |
| IPI | IPI00168894. IPI00434815. IPI00885092. |
| RefSeq | NP_001035755.1. NM_001040665.1. NP_001035756.1. NM_001040666.1. NP_001231873.1. NM_001244944.1. NP_001231875.1. NM_001244946.1. NP_694544.2. NM_152999.3. |
| UniGene | Hs.489051. |
3D structure databases | |
| ProteinModelPortal | Q8NFT2. |
| SMR | Q8NFT2. Positions 33-209. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000287908. |
PTM databases | |
| PhosphoSite | Q8NFT2. |
Polymorphism databases | |
| DMDM | 296452950. |
Proteomic databases | |
| PaxDb | Q8NFT2. |
| PeptideAtlas | Q8NFT2. |
| PRIDE | Q8NFT2. |
Protocols and materials databases | |
| DNASU | 261729. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000287908; ENSP00000287908; ENSG00000157214. ENST00000394621; ENSP00000378119; ENSG00000157214. ENST00000394622; ENSP00000378120; ENSG00000157214. ENST00000394624; ENSP00000378121; ENSG00000157214. ENST00000394626; ENSP00000378123; ENSG00000157214. ENST00000394629; ENSP00000378125; ENSG00000157214. ENST00000394632; ENSP00000378128; ENSG00000157214. |
| GeneID | 261729. |
| KEGG | hsa:261729. |
| UCSC | uc003ujy.2. human. |
Organism-specific databases | |
| CTD | 261729. |
| GeneCards | GC07P089796. |
| HGNC | HGNC:17885. STEAP2. |
| HPA | HPA029115. |
| MIM | 605094. gene. |
| neXtProt | NX_Q8NFT2. |
| PharmGKB | PA38473. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2085. |
| HOGENOM | HOG000234491. |
| HOVERGEN | HBG054379. |
| InParanoid | Q8NFT2. |
| KO | K14738. |
| OMA | VSNNMRV. |
| PhylomeDB | Q8NFT2. |
Gene expression databases | |
| ArrayExpress | Q8NFT2. |
| Bgee | Q8NFT2. |
| CleanEx | HS_STEAP2. |
| Genevestigator | Q8NFT2. |
| GermOnline | ENSG00000157214. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.50.720. 1 hit. |
| InterPro | IPR013130. Fe3_Rdtase_TM_dom. IPR016040. NAD(P)-bd_dom. IPR004455. NADP_OxRdtase_F420. [Graphical view] |
| Pfam | PF03807. F420_oxidored. 1 hit. PF01794. Ferric_reduct. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | STEAP2. human. |
| GenomeRNAi | 261729. |
| NextBio | 93228. |
| SOURCE | Search... |
Entry information
| Entry name | STEA2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NFT2 Secondary accession number(s): A4D1F1 Q8IUE7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
