Q8NFM7 (I17RD_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 86.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Interleukin-17 receptor D Short name=IL-17 receptor D Short name=IL-17RD Alternative name(s): IL17Rhom Interleukin-17 receptor-like protein Sef homolog Short name=hSef | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 739 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Feedback inhibitor of fibroblast growth factor mediated Ras-MAPK signaling and ERK activation. May inhibit FGF-induced FGFR1 tyrosine phosphorylation. Regulates the nuclear ERK signaling pathway by spatially blocking nuclear translocation of activated ERK without inhibiting cytoplasmic phosphorylation of ERK. Mediates JNK activation and may be involved in apoptosis. Ref.1 Ref.7 Ref.8 |
| Subunit structure | Interacts with MAP3K7 By similarity. Self-associates. Interacts with FGFR1, FGFR2 and phosphorylated MAP2K1 or MAP2K2. Associates with a MAP2K1/2-MAPK1/3 complex. Ref.1 Ref.7 Ref.8 |
| Subcellular location | Golgi apparatus membrane; Single-pass type I membrane protein. Cell membrane; Single-pass type I membrane protein. Note: Predominantly associated with the Golgi apparatus and is partially translocated to the plasma membrane upon stimulation. Ref.2 |
| Tissue specificity | Expressed in umbilical vein endothelial cells and in several highly vascularized tissues such as kidney, colon, skeletal muscle, heart and small intestine. Highly expressed in ductal epithelial cells of salivary glands, seminal vesicles and the collecting tubules of the kidney. Isoform 1 is also highly expressed in both fetal and adult brain, pituitary, tonsils, spleen, adenoids, fetal kidney, liver, testes and ovary. Isoform 1 is also expressed at moderate levels in primary aortic endothelial cells and adrenal medulla, and at low levels in adrenal cortex. Isoform 4 is specifically and highly expressed in pituitary, fetal brain and umbilical vein endothelial cells. Ref.7 |
| Sequence similarities | Contains 1 SEFIR domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Cytoplasm Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | Golgi membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NFM7-1) Also known as: hSef-a; IL17RLM-L; Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NFM7-2) Also known as: "IL17RLM-S; Short; The sequence of this isoform differs from the canonical sequence as follows: 1-144: Missing. | ||||||
| Isoform 3 (identifier: Q8NFM7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-42: MAPWLQLCSVFFTVNACLNGSQLAVAAGGSGRARGADTCGWR → MPRASASGVPALFVSGEQ | ||||||
| Isoform 4 (identifier: Q8NFM7-4) Also known as: hSef-b; The sequence of this isoform differs from the canonical sequence as follows: 1-42: MAPWLQLCSVFFTVNACLNGSQLAVAAGGSGRARGADTCGWR → MDYRQSWPWQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 16 | 16 | Potential | ||||||
| Chain | 17 – 739 | 723 | Interleukin-17 receptor D | PRO_0000041871 | |||||
Regions | |||||||||
| Topological domain | 17 – 299 | 283 | Extracellular Potential | ||||||
| Transmembrane | 300 – 320 | 21 | Helical; Potential | ||||||
| Topological domain | 321 – 739 | 419 | Cytoplasmic Potential | ||||||
| Domain | 355 – 509 | 155 | SEFIR | ||||||
| Compositional bias | 695 – 700 | 6 | Poly-Ser | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 19 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 55 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 62 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 80 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 137 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 171 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 206 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 277 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 144 | 144 | Missing in isoform 2. | VSP_015582 | |||||
| Alternative sequence | 1 – 42 | 42 | MAPWL…TCGWR → MPRASASGVPALFVSGEQ in isoform 3. | VSP_015583 | |||||
| Alternative sequence | 1 – 42 | 42 | MAPWL…TCGWR → MDYRQSWPWQ in isoform 4. | VSP_015584 | |||||
| Natural variant | 255 | 1 | T → M. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.6 Corresponds to variant rs6780995 [ dbSNP | Ensembl ]. | VAR_023478 | |||||
| Natural variant | 301 | 1 | V → M. Corresponds to variant rs17057718 [ dbSNP | Ensembl ]. | VAR_023479 | |||||
Experimental info | |||||||||
| Sequence conflict | 223 | 1 | H → HGSDMQVSFDHAPH in CAB61408. Ref.4 | ||||||
| Sequence conflict | 248 | 1 | K → E in AAM74077. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "hSef inhibits PC-12 cell differentiation by interfering with Ras-mitogen-activated protein kinase MAPK signaling." Xiong S.Q., Zhao Q.H., Rong Z., Huang G.R., Huang Y., Chen P.L., Zhang S., Liu L., Chang Z.J. J. Biol. Chem. 278:50273-50282(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), VARIANT MET-255, FUNCTION, INTERACTION WITH FGFR1 AND FGFR2. |
| [2] | "Alternative splicing generates an isoform of the human Sef gene with altered subcellular localization and specificity." Preger E., Ziv I., Shabtay A., Sher I., Tsang M., Dawid I.B., Altuvia Y., Ron D. Proc. Natl. Acad. Sci. U.S.A. 101:1229-1234(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), VARIANT MET-255, SUBCELLULAR LOCATION. Tissue: Testis. |
| [3] | "Identification of novel IL-17 related receptors." Gilbert J.M., Gorman D.M. Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT MET-255. |
| [4] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT MET-255. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT MET-255. Tissue: Testis. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4), VARIANT MET-255. |
| [7] | "A novel interleukin-17 receptor-like protein identified in human umbilical vein endothelial cells antagonizes basic fibroblast growth factor-induced signaling." Yang R.-B., Domingos Ng C.K., Wasserman S.M., Koemueves L.G., Gerritsen M.E., Topper J.N. J. Biol. Chem. 278:33232-33238(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, HOMOOLIGOMERIZATION, INTERACTION WITH FGFR1. |
| [8] | "Sef is a spatial regulator for Ras/MAP kinase signaling." Torii S., Kusakabe M., Yamamoto T., Maekawa M., Nishida E. Dev. Cell 7:33-44(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MAP2K1/2, IDENTIFICATION IN A COMPLEX WITH MAP2K1/2 AND MAPK1/3. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF494208 mRNA. Translation: AAM74077.1. AF494211 mRNA. Translation: AAM74080.1. AY489047 mRNA. Translation: AAS15051.2. AF458067 mRNA. Translation: AAM77571.1. AY358774 mRNA. Translation: AAQ89134.1. AL133097 mRNA. Translation: CAB61408.1. AL833913 mRNA. Translation: CAD38769.1. BC111702 mRNA. Translation: AAI11703.2. |
| IPI | IPI00302984. IPI00395790. IPI00640049. IPI00641705. |
| PIR | T42695. |
| RefSeq | NP_060033.3. NM_017563.3. |
| UniGene | Hs.150725. |
3D structure databases | |
| ProteinModelPortal | Q8NFM7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000296318. |
PTM databases | |
| PhosphoSite | Q8NFM7. |
Polymorphism databases | |
| DMDM | 126302555. |
Proteomic databases | |
| PaxDb | Q8NFM7. |
| PRIDE | Q8NFM7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000296318; ENSP00000296318; ENSG00000144730. ENST00000320057; ENSP00000322250; ENSG00000144730. ENST00000427856; ENSP00000399209; ENSG00000144730. ENST00000463523; ENSP00000417516; ENSG00000144730. |
| GeneID | 54756. |
| KEGG | hsa:54756. |
| UCSC | uc003dik.3. human. uc003dil.3. human. |
Organism-specific databases | |
| CTD | 54756. |
| GeneCards | GC03M057124. |
| H-InvDB | HIX0003391. |
| HGNC | HGNC:17616. IL17RD. |
| HPA | HPA039577. HPA043550. |
| MIM | 606807. gene. |
| neXtProt | NX_Q8NFM7. |
| PharmGKB | PA134993407. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG45649. |
| HOVERGEN | HBG081777. |
| InParanoid | Q8NFM7. |
| KO | K05167. |
| OMA | DLWEDFS. |
| OrthoDB | EOG451DQ6. |
| PhylomeDB | Q8NFM7. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | fgf_pathway. FGF signaling pathway. |
Gene expression databases | |
| ArrayExpress | Q8NFM7. |
| Bgee | Q8NFM7. |
| CleanEx | HS_IL17RD. |
| Genevestigator | Q8NFM7. |
| GermOnline | ENSG00000144730. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR013568. SEFIR. [Graphical view] |
| Pfam | PF08357. SEFIR. 1 hit. [Graphical view] |
| PROSITE | PS51534. SEFIR. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | IL17RD. human. |
| GenomeRNAi | 54756. |
| NextBio | 57378. |
| SOURCE | Search... |
Entry information
| Entry name | I17RD_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NFM7 Secondary accession number(s): Q2NKP7 Q9UFA0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
