Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Carbohydrate sulfotransferase 13

Gene

CHST13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Transfers sulfate to the C4 hydroxyl of beta1,4-linked GalNAc that is substituted with a beta-linked glucuronic acid at the C-3 hydroxyl. No activity toward dermatan.

Catalytic activityi

3'-phosphoadenylyl sulfate + chondroitin = adenosine 3',5'-bisphosphate + chondroitin 4'-sulfate.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi113 – 119PAPSBy similarity7
Nucleotide bindingi174 – 182PAPSBy similarity9

GO - Molecular functioni

  • chondroitin 4-sulfotransferase activity Source: UniProtKB
  • N-acetylgalactosamine 4-O-sulfotransferase activity Source: UniProtKB

GO - Biological processi

  • carbohydrate biosynthetic process Source: InterPro
  • chondroitin sulfate biosynthetic process Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Transferase

Keywords - Biological processi

Carbohydrate metabolism

Enzyme and pathway databases

BioCyciMetaCyc:HS11524-MONOMER.
ZFISH:HS11524-MONOMER.
BRENDAi2.8.2.5. 2681.
ReactomeiR-HSA-2022870. Chondroitin sulfate biosynthesis.

Names & Taxonomyi

Protein namesi
Recommended name:
Carbohydrate sulfotransferase 13 (EC:2.8.2.5)
Alternative name(s):
Chondroitin 4-O-sulfotransferase 3
Chondroitin 4-sulfotransferase 3
Short name:
C4ST-3
Short name:
C4ST3
Gene namesi
Name:CHST13
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:21755. CHST13.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 9CytoplasmicSequence analysis9
Transmembranei10 – 30Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini31 – 341LumenalSequence analysisAdd BLAST311

GO - Cellular componenti

  • Golgi membrane Source: Reactome
  • integral component of membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi166012.
OpenTargetsiENSG00000180767.
PharmGKBiPA134976803.

Polymorphism and mutation databases

BioMutaiCHST13.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001896711 – 341Carbohydrate sulfotransferase 13Add BLAST341

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei139PhosphoserineCombined sources1
Glycosylationi331N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ8NET6.
MaxQBiQ8NET6.
PaxDbiQ8NET6.
PeptideAtlasiQ8NET6.
PRIDEiQ8NET6.

PTM databases

iPTMnetiQ8NET6.
PhosphoSitePlusiQ8NET6.

Expressioni

Tissue specificityi

Highly expressed in adult liver. Expressed at lower level in kidney, lymph nodes and fetal kidney.1 Publication

Gene expression databases

BgeeiENSG00000180767.
CleanExiHS_CHST13.
ExpressionAtlasiQ8NET6. baseline and differential.
GenevisibleiQ8NET6. HS.

Interactioni

Protein-protein interaction databases

IntActiQ8NET6. 1 interactor.
STRINGi9606.ENSP00000317404.

Structurei

3D structure databases

ProteinModelPortaliQ8NET6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi132 – 134Cell attachment siteSequence analysis3

Sequence similaritiesi

Belongs to the sulfotransferase 2 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4651. Eukaryota.
ENOG4111GJR. LUCA.
GeneTreeiENSGT00760000119214.
HOGENOMiHOG000132921.
HOVERGENiHBG050952.
InParanoidiQ8NET6.
KOiK07779.
OMAiKLARPYS.
OrthoDBiEOG091G0FZO.
PhylomeDBiQ8NET6.
TreeFamiTF325581.

Family and domain databases

InterProiIPR018011. Carb_sulfotransferase-rel.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERiPTHR12137. PTHR12137. 1 hit.
PfamiPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NET6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGRRCCRRRV LAAACLGAAL LLLCAAPRSL RPAFGNRALG SSWLGGEKRS
60 70 80 90 100
PLQKLYDLDQ DPRSTLAKVH RQRRDLLNSA CSRHSRRQRL LQPEDLRHVL
110 120 130 140 150
VDDAHGLLYC YVPKVACTNW KRVLLALSGQ ARGDPRAISA QEAHAPGRLP
160 170 180 190 200
SLADFSPAEI NRRLRAYLAF LFVREPFERL ASAYRNKLAR PYSAAFQRRY
210 220 230 240 250
GARIVQRLRP RALPDARARG HDVRFAEFLA YLLDPRTRRE EPFNEHWERA
260 270 280 290 300
HALCHPCRLR YDVVGKFETL AEDAAFVLGL AGASDLSFPG PPRPRGAAAS
310 320 330 340
RDLAARLFRD ISPFYQRRLF DLYKMDFLLF NYSAPSYLRL L
Length:341
Mass (Da):38,920
Last modified:October 1, 2002 - v1
Checksum:iA372134675D661F6
GO
Isoform 2 (identifier: Q8NET6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     191-225: PYSAAFQRRYGARIVQRLRPRALPDARARGHDVRF → TRSATRVASATTSWASSRRWRRTRPSCWAWRAHPT
     226-341: Missing.

Note: No experimental confirmation available.
Show »
Length:225
Mass (Da):25,489
Checksum:i921FAF275E2C5607
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_053698146P → S.Corresponds to variant rs34311016dbSNPEnsembl.1
Natural variantiVAR_021477271A → V.1 PublicationCorresponds to variant rs1056523dbSNPEnsembl.1
Natural variantiVAR_021478317R → Q.1 PublicationCorresponds to variant rs1056522dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_057175191 – 225PYSAA…HDVRF → TRSATRVASATTSWASSRRW RRTRPSCWAWRAHPT in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_057176226 – 341Missing in isoform 2. 1 PublicationAdd BLAST116

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY120869 mRNA. Translation: AAM55481.1.
BC103895 mRNA. Translation: AAI03896.1.
BC103896 mRNA. Translation: AAI03897.1.
BC103897 mRNA. Translation: AAI03898.1.
CCDSiCCDS3039.1. [Q8NET6-1]
RefSeqiNP_690849.1. NM_152889.2. [Q8NET6-1]
UniGeneiHs.292375.

Genome annotation databases

EnsembliENST00000319340; ENSP00000317404; ENSG00000180767. [Q8NET6-1]
GeneIDi166012.
KEGGihsa:166012.
UCSCiuc003eja.4. human. [Q8NET6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY120869 mRNA. Translation: AAM55481.1.
BC103895 mRNA. Translation: AAI03896.1.
BC103896 mRNA. Translation: AAI03897.1.
BC103897 mRNA. Translation: AAI03898.1.
CCDSiCCDS3039.1. [Q8NET6-1]
RefSeqiNP_690849.1. NM_152889.2. [Q8NET6-1]
UniGeneiHs.292375.

3D structure databases

ProteinModelPortaliQ8NET6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8NET6. 1 interactor.
STRINGi9606.ENSP00000317404.

PTM databases

iPTMnetiQ8NET6.
PhosphoSitePlusiQ8NET6.

Polymorphism and mutation databases

BioMutaiCHST13.

Proteomic databases

EPDiQ8NET6.
MaxQBiQ8NET6.
PaxDbiQ8NET6.
PeptideAtlasiQ8NET6.
PRIDEiQ8NET6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000319340; ENSP00000317404; ENSG00000180767. [Q8NET6-1]
GeneIDi166012.
KEGGihsa:166012.
UCSCiuc003eja.4. human. [Q8NET6-1]

Organism-specific databases

CTDi166012.
DisGeNETi166012.
GeneCardsiCHST13.
HGNCiHGNC:21755. CHST13.
MIMi610124. gene.
neXtProtiNX_Q8NET6.
OpenTargetsiENSG00000180767.
PharmGKBiPA134976803.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4651. Eukaryota.
ENOG4111GJR. LUCA.
GeneTreeiENSGT00760000119214.
HOGENOMiHOG000132921.
HOVERGENiHBG050952.
InParanoidiQ8NET6.
KOiK07779.
OMAiKLARPYS.
OrthoDBiEOG091G0FZO.
PhylomeDBiQ8NET6.
TreeFamiTF325581.

Enzyme and pathway databases

BioCyciMetaCyc:HS11524-MONOMER.
ZFISH:HS11524-MONOMER.
BRENDAi2.8.2.5. 2681.
ReactomeiR-HSA-2022870. Chondroitin sulfate biosynthesis.

Miscellaneous databases

ChiTaRSiCHST13. human.
GenomeRNAii166012.
PROiQ8NET6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000180767.
CleanExiHS_CHST13.
ExpressionAtlasiQ8NET6. baseline and differential.
GenevisibleiQ8NET6. HS.

Family and domain databases

InterProiIPR018011. Carb_sulfotransferase-rel.
IPR005331. Sulfotransferase.
[Graphical view]
PANTHERiPTHR12137. PTHR12137. 1 hit.
PfamiPF03567. Sulfotransfer_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCHSTD_HUMAN
AccessioniPrimary (citable) accession number: Q8NET6
Secondary accession number(s): Q3SYA3, Q3SYA5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: October 1, 2002
Last modified: November 2, 2016
This is version 113 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.