SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NEM8

- CBPC3_HUMAN

UniProt

Q8NEM8 - CBPC3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cytosolic carboxypeptidase 3

Gene
AGBL3, CCP3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Metallocarboxypeptidase that may play a role in the processing of tubulin.1 Publication

Cofactori

Binds 1 zinc ion per subunit By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi364 – 3641Zinc By similarity
Metal bindingi367 – 3671Zinc By similarity
Active sitei414 – 4141Nucleophile By similarity
Metal bindingi460 – 4601Zinc By similarity

GO - Molecular functioni

  1. metallocarboxypeptidase activity Source: UniProtKB
  2. zinc ion binding Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Carboxypeptidase, Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Protein family/group databases

MEROPSiM14.026.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic carboxypeptidase 3 (EC:3.4.17.-)
Alternative name(s):
ATP/GTP-binding protein-like 3
Gene namesi
Name:AGBL3
Synonyms:CCP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:27981. AGBL3.

Subcellular locationi

Cytoplasmcytosol By similarity

GO - Cellular componenti

  1. cytosol Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672635.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10011001Cytosolic carboxypeptidase 3PRO_0000283751Add
BLAST

Proteomic databases

PaxDbiQ8NEM8.
PRIDEiQ8NEM8.

PTM databases

PhosphoSiteiQ8NEM8.

Expressioni

Gene expression databases

ArrayExpressiQ8NEM8.
BgeeiQ8NEM8.
CleanExiHS_AGBL3.
GenevestigatoriQ8NEM8.

Organism-specific databases

HPAiHPA020397.
HPA024150.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000388275.

Structurei

3D structure databases

ProteinModelPortaliQ8NEM8.
SMRiQ8NEM8. Positions 168-537.

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M14 family.

Phylogenomic databases

eggNOGiCOG2866.
HOGENOMiHOG000111052.
HOVERGENiHBG070840.
InParanoidiQ8NEM8.
OrthoDBiEOG78H3SB.
PhylomeDBiQ8NEM8.
TreeFamiTF313794.

Family and domain databases

InterProiIPR000834. Peptidase_M14.
[Graphical view]
PfamiPF00246. Peptidase_M14. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8NEM8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSEDSEKEDY SDRTISDEDE SDEDMFMKFV SEDLHRCALL TADSFGDPFF     50
PRTTQILLEY QLGRWVPRLR EPRDLYGVSS SGPLSPTRWP YHCEVIDEKV 100
QHIDWTPSCP EPVYIPTGLE TEPLYPDSKE ATVVYLAEDA YKEPCFVYSR 150
VGGNRTPLKQ PVDYRDNTLM FEARFESGNL QKVVKVAEYE YQLTVRPDLF 200
TNKHTQWYYF QVTNMRAGIV YRFTIVNFTK PASLYSRGMR PLFYSEKEAK 250
AHHIGWQRIG DQIKYYRNNP GQDGRHYFSL TWTFQFPHNK DTCYFAHCYP 300
YTYTNLQEYL SGINNDPVRS KFCKIRVLCH TLARNMVYIL TITTPLKNSD 350
SRKRKAVILT ARVHPGETNS SWIMKGFLDY ILGNSSDAQL LRDTFVFKVV 400
PMLNPDGVIV GNYRCSLAGR DLNRNYTSLL KESFPSVWYT RNMVHRLMEK 450
REVILYCDLH GHSRKENIFM YGCDGSDRSK TLYLQQRIFP LMLSKNCPDK 500
FSFSACKFNV QKSKEGTGRV VMWKMGIRNS FTMEATFCGS TLGNKRGTHF 550
STKDLESMGY HFCDSLLDYC DPDRTKYYRC LKELEEMERH ITLEKVFEDS 600
DTPVIDITLD VESSSRGSDS SESIDSLTYL LKLTSQKKHL KTKKERNSTI 650
ASHQNARGQE VYDRGHLLQR HTQSNSDVKD TRPNEPDDYM VDYFRRQLPN 700
QGLAHCKLRL PGSRHSPASA SRVAGTTGTR HHTWLIFVFL VEMGKKIPLK 750
GTDLYGNCFK VTSLQSPMGK QTSTWTEKTR IPTEDLHHNL KSKIKECISF 800
QSKKTGINWT DDEKRSYKDK GIVQTQEILQ YLLPIVHSTK NMQTTQIKQL 850
FNPRTNFQIQ HQLNPATCRN IKKYSTSWTA PRNHPFVIQG DVMANSSEWV 900
QSKPHRSLES LSPLKGPKKN KHSQIWAIKN EDIKPLSSKW ETASSSFGMD 950
ANVLKYKSLQ AEETNQQSSK HTALHLTKNK DEQANKNDGQ PTLYLKFQRE 1000
S 1001
Length:1,001
Mass (Da):116,011
Last modified:April 3, 2007 - v2
Checksum:i4846AEF2F76336AF
GO
Isoform 2 (identifier: Q8NEM8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     614-621: SSRGSDSS → RELTFLLR
     622-1001: Missing.

Note: No experimental confirmation available.

Show »
Length:621
Mass (Da):72,650
Checksum:i37FA956BD0142C8B
GO
Isoform 3 (identifier: Q8NEM8-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     105-105: W → GVSCWSESHQAGAQWCDLGSLQPPPPRFKRFACFSLLSSRDYRRVPPRPANFVFLVETGFHHVGQDGLRLLTS
     106-1001: Missing.

Note: No experimental confirmation available.

Show »
Length:177
Mass (Da):20,403
Checksum:iEC834FFDAF0A5400
GO
Isoform 4 (identifier: Q8NEM8-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     704-784: Missing.

Note: No experimental confirmation available.

Show »
Length:920
Mass (Da):107,047
Checksum:i804684527132B7C8
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti45 – 451F → Y.
Corresponds to variant rs2348049 [ dbSNP | Ensembl ].
VAR_031573
Natural varianti122 – 1221E → Q.2 Publications
Corresponds to variant rs4236655 [ dbSNP | Ensembl ].
VAR_031574
Natural varianti360 – 3601T → I.
Corresponds to variant rs17804854 [ dbSNP | Ensembl ].
VAR_031575

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei105 – 1051W → GVSCWSESHQAGAQWCDLGS LQPPPPRFKRFACFSLLSSR DYRRVPPRPANFVFLVETGF HHVGQDGLRLLTS in isoform 3. VSP_024370
Alternative sequencei106 – 1001896Missing in isoform 3. VSP_024371Add
BLAST
Alternative sequencei614 – 6218SSRGSDSS → RELTFLLR in isoform 2. VSP_024372
Alternative sequencei622 – 1001380Missing in isoform 2. VSP_024373Add
BLAST
Alternative sequencei704 – 78481Missing in isoform 4. VSP_040423Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti210 – 2101F → S in BAH13813. 1 Publication
Sequence conflicti396 – 3961V → A in BAH13813. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK023045 mRNA. Translation: BAB14371.1.
AK302827 mRNA. Translation: BAH13813.1.
AC083862 Genomic DNA. No translation available.
AC083870 Genomic DNA. No translation available.
AC090497 Genomic DNA. No translation available.
BC030651 mRNA. Translation: AAH30651.1.
CCDSiCCDS47718.1. [Q8NEM8-4]
RefSeqiNP_848658.3. NM_178563.3. [Q8NEM8-4]
XP_006716024.1. XM_006715961.1. [Q8NEM8-4]
XP_006716025.1. XM_006715962.1. [Q8NEM8-4]
UniGeneiHs.648616.

Genome annotation databases

EnsembliENST00000275763; ENSP00000275763; ENSG00000146856. [Q8NEM8-2]
ENST00000436302; ENSP00000388275; ENSG00000146856. [Q8NEM8-4]
GeneIDi340351.
KEGGihsa:340351.
UCSCiuc011kpw.2. human. [Q8NEM8-4]

Polymorphism databases

DMDMi143955274.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK023045 mRNA. Translation: BAB14371.1 .
AK302827 mRNA. Translation: BAH13813.1 .
AC083862 Genomic DNA. No translation available.
AC083870 Genomic DNA. No translation available.
AC090497 Genomic DNA. No translation available.
BC030651 mRNA. Translation: AAH30651.1 .
CCDSi CCDS47718.1. [Q8NEM8-4 ]
RefSeqi NP_848658.3. NM_178563.3. [Q8NEM8-4 ]
XP_006716024.1. XM_006715961.1. [Q8NEM8-4 ]
XP_006716025.1. XM_006715962.1. [Q8NEM8-4 ]
UniGenei Hs.648616.

3D structure databases

ProteinModelPortali Q8NEM8.
SMRi Q8NEM8. Positions 168-537.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000388275.

Protein family/group databases

MEROPSi M14.026.

PTM databases

PhosphoSitei Q8NEM8.

Polymorphism databases

DMDMi 143955274.

Proteomic databases

PaxDbi Q8NEM8.
PRIDEi Q8NEM8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000275763 ; ENSP00000275763 ; ENSG00000146856 . [Q8NEM8-2 ]
ENST00000436302 ; ENSP00000388275 ; ENSG00000146856 . [Q8NEM8-4 ]
GeneIDi 340351.
KEGGi hsa:340351.
UCSCi uc011kpw.2. human. [Q8NEM8-4 ]

Organism-specific databases

CTDi 340351.
GeneCardsi GC07P134671.
HGNCi HGNC:27981. AGBL3.
HPAi HPA020397.
HPA024150.
neXtProti NX_Q8NEM8.
PharmGKBi PA142672635.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2866.
HOGENOMi HOG000111052.
HOVERGENi HBG070840.
InParanoidi Q8NEM8.
OrthoDBi EOG78H3SB.
PhylomeDBi Q8NEM8.
TreeFami TF313794.

Miscellaneous databases

GenomeRNAii 340351.
NextBioi 97830.
PROi Q8NEM8.

Gene expression databases

ArrayExpressi Q8NEM8.
Bgeei Q8NEM8.
CleanExi HS_AGBL3.
Genevestigatori Q8NEM8.

Family and domain databases

InterProi IPR000834. Peptidase_M14.
[Graphical view ]
Pfami PF00246. Peptidase_M14. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT GLN-122.
    Tissue: Testis.
  2. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLN-122.
    Tissue: Testis.
  4. "Nna1-like proteins are active metallocarboxypeptidases of a new and diverse M14 subfamily."
    Rodriguez de la Vega M., Sevilla R.G., Hermoso A., Lorenzo J., Tanco S., Diez A., Fricker L.D., Bautista J.M., Aviles F.X.
    FASEB J. 21:851-865(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.

Entry informationi

Entry nameiCBPC3_HUMAN
AccessioniPrimary (citable) accession number: Q8NEM8
Secondary accession number(s): B7Z827, Q9H965
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: April 3, 2007
Last modified: July 9, 2014
This is version 86 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi