Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NEM8 (CBPC3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 86. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cytosolic carboxypeptidase 3

EC=3.4.17.-
Alternative name(s):
ATP/GTP-binding protein-like 3
Gene names
Name:AGBL3
Synonyms:CCP3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1001 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Metallocarboxypeptidase that may play a role in the processing of tubulin. Ref.4

Cofactor

Binds 1 zinc ion per subunit By similarity.

Subcellular location

Cytoplasmcytosol By similarity.

Sequence similarities

Belongs to the peptidase M14 family.

Ontologies

Keywords
   Cellular componentCytoplasm
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandMetal-binding
Zinc
   Molecular functionCarboxypeptidase
Hydrolase
Metalloprotease
Protease
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentcytosol

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionmetallocarboxypeptidase activity

Inferred from direct assay Ref.4. Source: UniProtKB

zinc ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8NEM8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8NEM8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     614-621: SSRGSDSS → RELTFLLR
     622-1001: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8NEM8-3)

The sequence of this isoform differs from the canonical sequence as follows:
     105-105: W → GVSCWSESHQAGAQWCDLGSLQPPPPRFKRFACFSLLSSRDYRRVPPRPANFVFLVETGFHHVGQDGLRLLTS
     106-1001: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q8NEM8-4)

The sequence of this isoform differs from the canonical sequence as follows:
     704-784: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10011001Cytosolic carboxypeptidase 3
PRO_0000283751

Sites

Active site4141Nucleophile By similarity
Metal binding3641Zinc By similarity
Metal binding3671Zinc By similarity
Metal binding4601Zinc By similarity

Natural variations

Alternative sequence1051W → GVSCWSESHQAGAQWCDLGS LQPPPPRFKRFACFSLLSSR DYRRVPPRPANFVFLVETGF HHVGQDGLRLLTS in isoform 3.
VSP_024370
Alternative sequence106 – 1001896Missing in isoform 3.
VSP_024371
Alternative sequence614 – 6218SSRGSDSS → RELTFLLR in isoform 2.
VSP_024372
Alternative sequence622 – 1001380Missing in isoform 2.
VSP_024373
Alternative sequence704 – 78481Missing in isoform 4.
VSP_040423
Natural variant451F → Y.
Corresponds to variant rs2348049 [ dbSNP | Ensembl ].
VAR_031573
Natural variant1221E → Q. Ref.1 Ref.3
Corresponds to variant rs4236655 [ dbSNP | Ensembl ].
VAR_031574
Natural variant3601T → I.
Corresponds to variant rs17804854 [ dbSNP | Ensembl ].
VAR_031575

Experimental info

Sequence conflict2101F → S in BAH13813. Ref.1
Sequence conflict3961V → A in BAH13813. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 3, 2007. Version 2.
Checksum: 4846AEF2F76336AF

FASTA1,001116,011
        10         20         30         40         50         60 
MSEDSEKEDY SDRTISDEDE SDEDMFMKFV SEDLHRCALL TADSFGDPFF PRTTQILLEY 

        70         80         90        100        110        120 
QLGRWVPRLR EPRDLYGVSS SGPLSPTRWP YHCEVIDEKV QHIDWTPSCP EPVYIPTGLE 

       130        140        150        160        170        180 
TEPLYPDSKE ATVVYLAEDA YKEPCFVYSR VGGNRTPLKQ PVDYRDNTLM FEARFESGNL 

       190        200        210        220        230        240 
QKVVKVAEYE YQLTVRPDLF TNKHTQWYYF QVTNMRAGIV YRFTIVNFTK PASLYSRGMR 

       250        260        270        280        290        300 
PLFYSEKEAK AHHIGWQRIG DQIKYYRNNP GQDGRHYFSL TWTFQFPHNK DTCYFAHCYP 

       310        320        330        340        350        360 
YTYTNLQEYL SGINNDPVRS KFCKIRVLCH TLARNMVYIL TITTPLKNSD SRKRKAVILT 

       370        380        390        400        410        420 
ARVHPGETNS SWIMKGFLDY ILGNSSDAQL LRDTFVFKVV PMLNPDGVIV GNYRCSLAGR 

       430        440        450        460        470        480 
DLNRNYTSLL KESFPSVWYT RNMVHRLMEK REVILYCDLH GHSRKENIFM YGCDGSDRSK 

       490        500        510        520        530        540 
TLYLQQRIFP LMLSKNCPDK FSFSACKFNV QKSKEGTGRV VMWKMGIRNS FTMEATFCGS 

       550        560        570        580        590        600 
TLGNKRGTHF STKDLESMGY HFCDSLLDYC DPDRTKYYRC LKELEEMERH ITLEKVFEDS 

       610        620        630        640        650        660 
DTPVIDITLD VESSSRGSDS SESIDSLTYL LKLTSQKKHL KTKKERNSTI ASHQNARGQE 

       670        680        690        700        710        720 
VYDRGHLLQR HTQSNSDVKD TRPNEPDDYM VDYFRRQLPN QGLAHCKLRL PGSRHSPASA 

       730        740        750        760        770        780 
SRVAGTTGTR HHTWLIFVFL VEMGKKIPLK GTDLYGNCFK VTSLQSPMGK QTSTWTEKTR 

       790        800        810        820        830        840 
IPTEDLHHNL KSKIKECISF QSKKTGINWT DDEKRSYKDK GIVQTQEILQ YLLPIVHSTK 

       850        860        870        880        890        900 
NMQTTQIKQL FNPRTNFQIQ HQLNPATCRN IKKYSTSWTA PRNHPFVIQG DVMANSSEWV 

       910        920        930        940        950        960 
QSKPHRSLES LSPLKGPKKN KHSQIWAIKN EDIKPLSSKW ETASSSFGMD ANVLKYKSLQ 

       970        980        990       1000 
AEETNQQSSK HTALHLTKNK DEQANKNDGQ PTLYLKFQRE S 

« Hide

Isoform 2 [UniParc].

Checksum: 37FA956BD0142C8B
Show »

FASTA62172,650
Isoform 3 [UniParc].

Checksum: EC834FFDAF0A5400
Show »

FASTA17720,403
Isoform 4 [UniParc].

Checksum: 804684527132B7C8
Show »

FASTA920107,047

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT GLN-122.
Tissue: Testis.
[2]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLN-122.
Tissue: Testis.
[4]"Nna1-like proteins are active metallocarboxypeptidases of a new and diverse M14 subfamily."
Rodriguez de la Vega M., Sevilla R.G., Hermoso A., Lorenzo J., Tanco S., Diez A., Fricker L.D., Bautista J.M., Aviles F.X.
FASEB J. 21:851-865(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK023045 mRNA. Translation: BAB14371.1.
AK302827 mRNA. Translation: BAH13813.1.
AC083862 Genomic DNA. No translation available.
AC083870 Genomic DNA. No translation available.
AC090497 Genomic DNA. No translation available.
BC030651 mRNA. Translation: AAH30651.1.
CCDSCCDS47718.1. [Q8NEM8-4]
RefSeqNP_848658.3. NM_178563.3. [Q8NEM8-4]
XP_006716024.1. XM_006715961.1. [Q8NEM8-4]
XP_006716025.1. XM_006715962.1. [Q8NEM8-4]
UniGeneHs.648616.

3D structure databases

ProteinModelPortalQ8NEM8.
SMRQ8NEM8. Positions 168-537.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000388275.

Protein family/group databases

MEROPSM14.026.

PTM databases

PhosphoSiteQ8NEM8.

Polymorphism databases

DMDM143955274.

Proteomic databases

PaxDbQ8NEM8.
PRIDEQ8NEM8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000275763; ENSP00000275763; ENSG00000146856. [Q8NEM8-2]
ENST00000436302; ENSP00000388275; ENSG00000146856. [Q8NEM8-4]
GeneID340351.
KEGGhsa:340351.
UCSCuc011kpw.2. human. [Q8NEM8-4]

Organism-specific databases

CTD340351.
GeneCardsGC07P134671.
HGNCHGNC:27981. AGBL3.
HPAHPA020397.
HPA024150.
neXtProtNX_Q8NEM8.
PharmGKBPA142672635.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG2866.
HOGENOMHOG000111052.
HOVERGENHBG070840.
InParanoidQ8NEM8.
OrthoDBEOG78H3SB.
PhylomeDBQ8NEM8.
TreeFamTF313794.

Gene expression databases

ArrayExpressQ8NEM8.
BgeeQ8NEM8.
CleanExHS_AGBL3.
GenevestigatorQ8NEM8.

Family and domain databases

InterProIPR000834. Peptidase_M14.
[Graphical view]
PfamPF00246. Peptidase_M14. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi340351.
NextBio97830.
PROQ8NEM8.

Entry information

Entry nameCBPC3_HUMAN
AccessionPrimary (citable) accession number: Q8NEM8
Secondary accession number(s): B7Z827, Q9H965
Entry history
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: April 3, 2007
Last modified: July 9, 2014
This is version 86 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Peptidase families

Classification of peptidase families and list of entries

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM