Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytosolic carboxypeptidase 3

Gene

AGBL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Metallocarboxypeptidase that mediates both deglutamylation and deaspartylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates or polyaspartates from the carboxy-terminus of target proteins such as MYLK. Does not show detyrosinase or deglycylase activities from the carboxy-terminus of tubulin.1 Publication
Isoform 2: Metallocarboxypeptidase that mediates tubulin deglutamylation.1 Publication

Cofactori

Zn2+By similarityNote: Binds 1 zinc ion per subunit.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi364ZincBy similarity1
Metal bindingi367ZincBy similarity1
Active sitei414NucleophileBy similarity1
Metal bindingi460ZincBy similarity1

GO - Molecular functioni

  • metallocarboxypeptidase activity Source: UniProtKB
  • zinc ion binding Source: InterPro

GO - Biological processi

  • protein side chain deglutamylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Carboxypeptidase, Hydrolase, Metalloprotease, Protease

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000146856-MONOMER.

Protein family/group databases

MEROPSiM14.026.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytosolic carboxypeptidase 3 (EC:3.4.17.-)
Alternative name(s):
ATP/GTP-binding protein-like 3
Gene namesi
Name:AGBL3
Synonyms:CCP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:27981. AGBL3.

Subcellular locationi

  • Cytoplasmcytosol By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi340351.
OpenTargetsiENSG00000146856.
PharmGKBiPA142672635.

Polymorphism and mutation databases

BioMutaiAGBL3.
DMDMi143955274.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002837511 – 1001Cytosolic carboxypeptidase 3Add BLAST1001

Proteomic databases

PaxDbiQ8NEM8.
PeptideAtlasiQ8NEM8.
PRIDEiQ8NEM8.

PTM databases

iPTMnetiQ8NEM8.
PhosphoSitePlusiQ8NEM8.

Expressioni

Gene expression databases

BgeeiENSG00000146856.
CleanExiHS_AGBL3.
ExpressionAtlasiQ8NEM8. baseline and differential.
GenevisibleiQ8NEM8. HS.

Organism-specific databases

HPAiHPA020397.
HPA024150.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000388275.

Structurei

3D structure databases

ProteinModelPortaliQ8NEM8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M14 family.Curated

Phylogenomic databases

eggNOGiKOG1814. Eukaryota.
KOG3641. Eukaryota.
COG2866. LUCA.
GeneTreeiENSGT00550000074405.
HOGENOMiHOG000111052.
HOVERGENiHBG070840.
InParanoidiQ8NEM8.
OMAiTQEILQY.
OrthoDBiEOG091G0LY8.
PhylomeDBiQ8NEM8.
TreeFamiTF313794.

Family and domain databases

InterProiIPR000834. Peptidase_M14.
[Graphical view]
PfamiPF00246. Peptidase_M14. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NEM8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEDSEKEDY SDRTISDEDE SDEDMFMKFV SEDLHRCALL TADSFGDPFF
60 70 80 90 100
PRTTQILLEY QLGRWVPRLR EPRDLYGVSS SGPLSPTRWP YHCEVIDEKV
110 120 130 140 150
QHIDWTPSCP EPVYIPTGLE TEPLYPDSKE ATVVYLAEDA YKEPCFVYSR
160 170 180 190 200
VGGNRTPLKQ PVDYRDNTLM FEARFESGNL QKVVKVAEYE YQLTVRPDLF
210 220 230 240 250
TNKHTQWYYF QVTNMRAGIV YRFTIVNFTK PASLYSRGMR PLFYSEKEAK
260 270 280 290 300
AHHIGWQRIG DQIKYYRNNP GQDGRHYFSL TWTFQFPHNK DTCYFAHCYP
310 320 330 340 350
YTYTNLQEYL SGINNDPVRS KFCKIRVLCH TLARNMVYIL TITTPLKNSD
360 370 380 390 400
SRKRKAVILT ARVHPGETNS SWIMKGFLDY ILGNSSDAQL LRDTFVFKVV
410 420 430 440 450
PMLNPDGVIV GNYRCSLAGR DLNRNYTSLL KESFPSVWYT RNMVHRLMEK
460 470 480 490 500
REVILYCDLH GHSRKENIFM YGCDGSDRSK TLYLQQRIFP LMLSKNCPDK
510 520 530 540 550
FSFSACKFNV QKSKEGTGRV VMWKMGIRNS FTMEATFCGS TLGNKRGTHF
560 570 580 590 600
STKDLESMGY HFCDSLLDYC DPDRTKYYRC LKELEEMERH ITLEKVFEDS
610 620 630 640 650
DTPVIDITLD VESSSRGSDS SESIDSLTYL LKLTSQKKHL KTKKERNSTI
660 670 680 690 700
ASHQNARGQE VYDRGHLLQR HTQSNSDVKD TRPNEPDDYM VDYFRRQLPN
710 720 730 740 750
QGLAHCKLRL PGSRHSPASA SRVAGTTGTR HHTWLIFVFL VEMGKKIPLK
760 770 780 790 800
GTDLYGNCFK VTSLQSPMGK QTSTWTEKTR IPTEDLHHNL KSKIKECISF
810 820 830 840 850
QSKKTGINWT DDEKRSYKDK GIVQTQEILQ YLLPIVHSTK NMQTTQIKQL
860 870 880 890 900
FNPRTNFQIQ HQLNPATCRN IKKYSTSWTA PRNHPFVIQG DVMANSSEWV
910 920 930 940 950
QSKPHRSLES LSPLKGPKKN KHSQIWAIKN EDIKPLSSKW ETASSSFGMD
960 970 980 990 1000
ANVLKYKSLQ AEETNQQSSK HTALHLTKNK DEQANKNDGQ PTLYLKFQRE

S
Length:1,001
Mass (Da):116,011
Last modified:April 3, 2007 - v2
Checksum:i4846AEF2F76336AF
GO
Isoform 2 (identifier: Q8NEM8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     614-621: SSRGSDSS → RELTFLLR
     622-1001: Missing.

Note: No experimental confirmation available.
Show »
Length:621
Mass (Da):72,650
Checksum:i37FA956BD0142C8B
GO
Isoform 3 (identifier: Q8NEM8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     105-105: W → GVSCWSESHQAGAQWCDLGSLQPPPPRFKRFACFSLLSSRDYRRVPPRPANFVFLVETGFHHVGQDGLRLLTS
     106-1001: Missing.

Note: No experimental confirmation available.
Show »
Length:177
Mass (Da):20,403
Checksum:iEC834FFDAF0A5400
GO
Isoform 4 (identifier: Q8NEM8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     704-784: Missing.

Note: No experimental confirmation available.
Show »
Length:920
Mass (Da):107,047
Checksum:i804684527132B7C8
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti210F → S in BAH13813 (PubMed:14702039).Curated1
Sequence conflicti396V → A in BAH13813 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03157345F → Y.Corresponds to variant rs2348049dbSNPEnsembl.1
Natural variantiVAR_031574122E → Q.2 PublicationsCorresponds to variant rs4236655dbSNPEnsembl.1
Natural variantiVAR_031575360T → I.Corresponds to variant rs17804854dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024370105W → GVSCWSESHQAGAQWCDLGS LQPPPPRFKRFACFSLLSSR DYRRVPPRPANFVFLVETGF HHVGQDGLRLLTS in isoform 3. 1 Publication1
Alternative sequenceiVSP_024371106 – 1001Missing in isoform 3. 1 PublicationAdd BLAST896
Alternative sequenceiVSP_024372614 – 621SSRGSDSS → RELTFLLR in isoform 2. 1 Publication8
Alternative sequenceiVSP_024373622 – 1001Missing in isoform 2. 1 PublicationAdd BLAST380
Alternative sequenceiVSP_040423704 – 784Missing in isoform 4. 1 PublicationAdd BLAST81

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023045 mRNA. Translation: BAB14371.1.
AK302827 mRNA. Translation: BAH13813.1.
AC083862 Genomic DNA. No translation available.
AC083870 Genomic DNA. No translation available.
AC090497 Genomic DNA. No translation available.
BC030651 mRNA. Translation: AAH30651.1.
CCDSiCCDS47718.1. [Q8NEM8-4]
RefSeqiNP_848658.3. NM_178563.3. [Q8NEM8-4]
XP_016867625.1. XM_017012136.1. [Q8NEM8-4]
XP_016867626.1. XM_017012137.1. [Q8NEM8-4]
UniGeneiHs.648616.

Genome annotation databases

EnsembliENST00000275763; ENSP00000275763; ENSG00000146856. [Q8NEM8-2]
ENST00000436302; ENSP00000388275; ENSG00000146856. [Q8NEM8-4]
GeneIDi340351.
KEGGihsa:340351.
UCSCiuc011kpw.2. human. [Q8NEM8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023045 mRNA. Translation: BAB14371.1.
AK302827 mRNA. Translation: BAH13813.1.
AC083862 Genomic DNA. No translation available.
AC083870 Genomic DNA. No translation available.
AC090497 Genomic DNA. No translation available.
BC030651 mRNA. Translation: AAH30651.1.
CCDSiCCDS47718.1. [Q8NEM8-4]
RefSeqiNP_848658.3. NM_178563.3. [Q8NEM8-4]
XP_016867625.1. XM_017012136.1. [Q8NEM8-4]
XP_016867626.1. XM_017012137.1. [Q8NEM8-4]
UniGeneiHs.648616.

3D structure databases

ProteinModelPortaliQ8NEM8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000388275.

Protein family/group databases

MEROPSiM14.026.

PTM databases

iPTMnetiQ8NEM8.
PhosphoSitePlusiQ8NEM8.

Polymorphism and mutation databases

BioMutaiAGBL3.
DMDMi143955274.

Proteomic databases

PaxDbiQ8NEM8.
PeptideAtlasiQ8NEM8.
PRIDEiQ8NEM8.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000275763; ENSP00000275763; ENSG00000146856. [Q8NEM8-2]
ENST00000436302; ENSP00000388275; ENSG00000146856. [Q8NEM8-4]
GeneIDi340351.
KEGGihsa:340351.
UCSCiuc011kpw.2. human. [Q8NEM8-1]

Organism-specific databases

CTDi340351.
DisGeNETi340351.
GeneCardsiAGBL3.
HGNCiHGNC:27981. AGBL3.
HPAiHPA020397.
HPA024150.
neXtProtiNX_Q8NEM8.
OpenTargetsiENSG00000146856.
PharmGKBiPA142672635.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1814. Eukaryota.
KOG3641. Eukaryota.
COG2866. LUCA.
GeneTreeiENSGT00550000074405.
HOGENOMiHOG000111052.
HOVERGENiHBG070840.
InParanoidiQ8NEM8.
OMAiTQEILQY.
OrthoDBiEOG091G0LY8.
PhylomeDBiQ8NEM8.
TreeFamiTF313794.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000146856-MONOMER.

Miscellaneous databases

GenomeRNAii340351.
PROiQ8NEM8.

Gene expression databases

BgeeiENSG00000146856.
CleanExiHS_AGBL3.
ExpressionAtlasiQ8NEM8. baseline and differential.
GenevisibleiQ8NEM8. HS.

Family and domain databases

InterProiIPR000834. Peptidase_M14.
[Graphical view]
PfamiPF00246. Peptidase_M14. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCBPC3_HUMAN
AccessioniPrimary (citable) accession number: Q8NEM8
Secondary accession number(s): B7Z827, Q9H965
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: April 3, 2007
Last modified: November 2, 2016
This is version 104 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.