Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NEM8

- CBPC3_HUMAN

UniProt

Q8NEM8 - CBPC3_HUMAN

Protein

Cytosolic carboxypeptidase 3

Gene

AGBL3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 2 (03 Apr 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Metallocarboxypeptidase that may play a role in the processing of tubulin.1 Publication

    Cofactori

    Binds 1 zinc ion per subunit.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi364 – 3641ZincBy similarity
    Metal bindingi367 – 3671ZincBy similarity
    Active sitei414 – 4141NucleophileBy similarity
    Metal bindingi460 – 4601ZincBy similarity

    GO - Molecular functioni

    1. metallocarboxypeptidase activity Source: UniProtKB
    2. zinc ion binding Source: InterPro

    Keywords - Molecular functioni

    Carboxypeptidase, Hydrolase, Metalloprotease, Protease

    Keywords - Ligandi

    Metal-binding, Zinc

    Protein family/group databases

    MEROPSiM14.026.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytosolic carboxypeptidase 3 (EC:3.4.17.-)
    Alternative name(s):
    ATP/GTP-binding protein-like 3
    Gene namesi
    Name:AGBL3
    Synonyms:CCP3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:27981. AGBL3.

    Subcellular locationi

    Cytoplasmcytosol By similarity

    GO - Cellular componenti

    1. cytosol Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672635.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10011001Cytosolic carboxypeptidase 3PRO_0000283751Add
    BLAST

    Proteomic databases

    PaxDbiQ8NEM8.
    PRIDEiQ8NEM8.

    PTM databases

    PhosphoSiteiQ8NEM8.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8NEM8.
    BgeeiQ8NEM8.
    CleanExiHS_AGBL3.
    GenevestigatoriQ8NEM8.

    Organism-specific databases

    HPAiHPA020397.
    HPA024150.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000388275.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NEM8.
    SMRiQ8NEM8. Positions 168-537.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the peptidase M14 family.Curated

    Phylogenomic databases

    eggNOGiCOG2866.
    HOGENOMiHOG000111052.
    HOVERGENiHBG070840.
    InParanoidiQ8NEM8.
    OrthoDBiEOG78H3SB.
    PhylomeDBiQ8NEM8.
    TreeFamiTF313794.

    Family and domain databases

    InterProiIPR000834. Peptidase_M14.
    [Graphical view]
    PfamiPF00246. Peptidase_M14. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NEM8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSEDSEKEDY SDRTISDEDE SDEDMFMKFV SEDLHRCALL TADSFGDPFF     50
    PRTTQILLEY QLGRWVPRLR EPRDLYGVSS SGPLSPTRWP YHCEVIDEKV 100
    QHIDWTPSCP EPVYIPTGLE TEPLYPDSKE ATVVYLAEDA YKEPCFVYSR 150
    VGGNRTPLKQ PVDYRDNTLM FEARFESGNL QKVVKVAEYE YQLTVRPDLF 200
    TNKHTQWYYF QVTNMRAGIV YRFTIVNFTK PASLYSRGMR PLFYSEKEAK 250
    AHHIGWQRIG DQIKYYRNNP GQDGRHYFSL TWTFQFPHNK DTCYFAHCYP 300
    YTYTNLQEYL SGINNDPVRS KFCKIRVLCH TLARNMVYIL TITTPLKNSD 350
    SRKRKAVILT ARVHPGETNS SWIMKGFLDY ILGNSSDAQL LRDTFVFKVV 400
    PMLNPDGVIV GNYRCSLAGR DLNRNYTSLL KESFPSVWYT RNMVHRLMEK 450
    REVILYCDLH GHSRKENIFM YGCDGSDRSK TLYLQQRIFP LMLSKNCPDK 500
    FSFSACKFNV QKSKEGTGRV VMWKMGIRNS FTMEATFCGS TLGNKRGTHF 550
    STKDLESMGY HFCDSLLDYC DPDRTKYYRC LKELEEMERH ITLEKVFEDS 600
    DTPVIDITLD VESSSRGSDS SESIDSLTYL LKLTSQKKHL KTKKERNSTI 650
    ASHQNARGQE VYDRGHLLQR HTQSNSDVKD TRPNEPDDYM VDYFRRQLPN 700
    QGLAHCKLRL PGSRHSPASA SRVAGTTGTR HHTWLIFVFL VEMGKKIPLK 750
    GTDLYGNCFK VTSLQSPMGK QTSTWTEKTR IPTEDLHHNL KSKIKECISF 800
    QSKKTGINWT DDEKRSYKDK GIVQTQEILQ YLLPIVHSTK NMQTTQIKQL 850
    FNPRTNFQIQ HQLNPATCRN IKKYSTSWTA PRNHPFVIQG DVMANSSEWV 900
    QSKPHRSLES LSPLKGPKKN KHSQIWAIKN EDIKPLSSKW ETASSSFGMD 950
    ANVLKYKSLQ AEETNQQSSK HTALHLTKNK DEQANKNDGQ PTLYLKFQRE 1000
    S 1001
    Length:1,001
    Mass (Da):116,011
    Last modified:April 3, 2007 - v2
    Checksum:i4846AEF2F76336AF
    GO
    Isoform 2 (identifier: Q8NEM8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         614-621: SSRGSDSS → RELTFLLR
         622-1001: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:621
    Mass (Da):72,650
    Checksum:i37FA956BD0142C8B
    GO
    Isoform 3 (identifier: Q8NEM8-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         105-105: W → GVSCWSESHQAGAQWCDLGSLQPPPPRFKRFACFSLLSSRDYRRVPPRPANFVFLVETGFHHVGQDGLRLLTS
         106-1001: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:177
    Mass (Da):20,403
    Checksum:iEC834FFDAF0A5400
    GO
    Isoform 4 (identifier: Q8NEM8-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         704-784: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:920
    Mass (Da):107,047
    Checksum:i804684527132B7C8
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti210 – 2101F → S in BAH13813. (PubMed:14702039)Curated
    Sequence conflicti396 – 3961V → A in BAH13813. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti45 – 451F → Y.
    Corresponds to variant rs2348049 [ dbSNP | Ensembl ].
    VAR_031573
    Natural varianti122 – 1221E → Q.2 Publications
    Corresponds to variant rs4236655 [ dbSNP | Ensembl ].
    VAR_031574
    Natural varianti360 – 3601T → I.
    Corresponds to variant rs17804854 [ dbSNP | Ensembl ].
    VAR_031575

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei105 – 1051W → GVSCWSESHQAGAQWCDLGS LQPPPPRFKRFACFSLLSSR DYRRVPPRPANFVFLVETGF HHVGQDGLRLLTS in isoform 3. 1 PublicationVSP_024370
    Alternative sequencei106 – 1001896Missing in isoform 3. 1 PublicationVSP_024371Add
    BLAST
    Alternative sequencei614 – 6218SSRGSDSS → RELTFLLR in isoform 2. 1 PublicationVSP_024372
    Alternative sequencei622 – 1001380Missing in isoform 2. 1 PublicationVSP_024373Add
    BLAST
    Alternative sequencei704 – 78481Missing in isoform 4. 1 PublicationVSP_040423Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023045 mRNA. Translation: BAB14371.1.
    AK302827 mRNA. Translation: BAH13813.1.
    AC083862 Genomic DNA. No translation available.
    AC083870 Genomic DNA. No translation available.
    AC090497 Genomic DNA. No translation available.
    BC030651 mRNA. Translation: AAH30651.1.
    CCDSiCCDS47718.1. [Q8NEM8-4]
    RefSeqiNP_848658.3. NM_178563.3. [Q8NEM8-4]
    XP_006716024.1. XM_006715961.1. [Q8NEM8-4]
    XP_006716025.1. XM_006715962.1. [Q8NEM8-4]
    UniGeneiHs.648616.

    Genome annotation databases

    EnsembliENST00000275763; ENSP00000275763; ENSG00000146856. [Q8NEM8-2]
    ENST00000436302; ENSP00000388275; ENSG00000146856. [Q8NEM8-4]
    GeneIDi340351.
    KEGGihsa:340351.
    UCSCiuc011kpw.2. human. [Q8NEM8-4]

    Polymorphism databases

    DMDMi143955274.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023045 mRNA. Translation: BAB14371.1 .
    AK302827 mRNA. Translation: BAH13813.1 .
    AC083862 Genomic DNA. No translation available.
    AC083870 Genomic DNA. No translation available.
    AC090497 Genomic DNA. No translation available.
    BC030651 mRNA. Translation: AAH30651.1 .
    CCDSi CCDS47718.1. [Q8NEM8-4 ]
    RefSeqi NP_848658.3. NM_178563.3. [Q8NEM8-4 ]
    XP_006716024.1. XM_006715961.1. [Q8NEM8-4 ]
    XP_006716025.1. XM_006715962.1. [Q8NEM8-4 ]
    UniGenei Hs.648616.

    3D structure databases

    ProteinModelPortali Q8NEM8.
    SMRi Q8NEM8. Positions 168-537.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000388275.

    Protein family/group databases

    MEROPSi M14.026.

    PTM databases

    PhosphoSitei Q8NEM8.

    Polymorphism databases

    DMDMi 143955274.

    Proteomic databases

    PaxDbi Q8NEM8.
    PRIDEi Q8NEM8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000275763 ; ENSP00000275763 ; ENSG00000146856 . [Q8NEM8-2 ]
    ENST00000436302 ; ENSP00000388275 ; ENSG00000146856 . [Q8NEM8-4 ]
    GeneIDi 340351.
    KEGGi hsa:340351.
    UCSCi uc011kpw.2. human. [Q8NEM8-4 ]

    Organism-specific databases

    CTDi 340351.
    GeneCardsi GC07P134671.
    HGNCi HGNC:27981. AGBL3.
    HPAi HPA020397.
    HPA024150.
    neXtProti NX_Q8NEM8.
    PharmGKBi PA142672635.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2866.
    HOGENOMi HOG000111052.
    HOVERGENi HBG070840.
    InParanoidi Q8NEM8.
    OrthoDBi EOG78H3SB.
    PhylomeDBi Q8NEM8.
    TreeFami TF313794.

    Miscellaneous databases

    GenomeRNAii 340351.
    NextBioi 97830.
    PROi Q8NEM8.

    Gene expression databases

    ArrayExpressi Q8NEM8.
    Bgeei Q8NEM8.
    CleanExi HS_AGBL3.
    Genevestigatori Q8NEM8.

    Family and domain databases

    InterProi IPR000834. Peptidase_M14.
    [Graphical view ]
    Pfami PF00246. Peptidase_M14. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT GLN-122.
      Tissue: Testis.
    2. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT GLN-122.
      Tissue: Testis.
    4. "Nna1-like proteins are active metallocarboxypeptidases of a new and diverse M14 subfamily."
      Rodriguez de la Vega M., Sevilla R.G., Hermoso A., Lorenzo J., Tanco S., Diez A., Fricker L.D., Bautista J.M., Aviles F.X.
      FASEB J. 21:851-865(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiCBPC3_HUMAN
    AccessioniPrimary (citable) accession number: Q8NEM8
    Secondary accession number(s): B7Z827, Q9H965
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 3, 2007
    Last sequence update: April 3, 2007
    Last modified: October 1, 2014
    This is version 87 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. Peptidase families
      Classification of peptidase families and list of entries
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3