Reviewed,
UniProtKB/Swiss-Prot Q8NEM8 (CBPC3_HUMAN)
Last modified
November 24, 2009.
Version 46.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Cytosolic carboxypeptidase 3 EC=3.4.17.- Alternative name(s): ATP/GTP-binding protein-like 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1001 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | May play a role in the processing of tubulin By similarity. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subcellular location | Cytoplasm By similarity. |
| Sequence similarities | Belongs to the peptidase M14 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | Metal-binding Zinc |
| Molecular function | Carboxypeptidase Hydrolase Metalloprotease Protease |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | proteolysis Inferred from electronic annotation. Source: InterPro |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | metallocarboxypeptidase activity Inferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NEM8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NEM8-2) The sequence of this isoform differs from the canonical sequence as follows: 614-621: SSRGSDSS → RELTFLLR 622-1001: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8NEM8-3) The sequence of this isoform differs from the canonical sequence as follows: 105-105: W → GVSCWSESHQAGAQWCDLGSLQPPPPRFKRFACFSLLSSRDYRRVPPRPANFVFLVETGFHHVGQDGLRLLTS 106-1001: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1001 | 1001 | Cytosolic carboxypeptidase 3 | PRO_0000283751 | |||||
Sites | |||||||||
| Active site | 414 | 1 | Nucleophile By similarity | ||||||
| Metal binding | 364 | 1 | Zinc By similarity | ||||||
| Metal binding | 367 | 1 | Zinc By similarity | ||||||
| Metal binding | 460 | 1 | Zinc By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 733 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 105 | 1 | W → GVSCWSESHQAGAQWCDLGS LQPPPPRFKRFACFSLLSSR DYRRVPPRPANFVFLVETGF HHVGQDGLRLLTS in isoform 3. | VSP_024370 | |||||
| Alternative sequence | 106 – 1001 | 896 | Missing in isoform 3. | VSP_024371 | |||||
| Alternative sequence | 614 – 621 | 8 | SSRGSDSS → RELTFLLR in isoform 2. | VSP_024372 | |||||
| Alternative sequence | 622 – 1001 | 380 | Missing in isoform 2. | VSP_024373 | |||||
| Natural variant | 45 | 1 | F → Y: dbSNP rs2348049. | VAR_031573 | |||||
| Natural variant | 122 | 1 | E → Q: dbSNP rs4236655. Ref.3 | VAR_031574 | |||||
| Natural variant | 360 | 1 | T → I: dbSNP rs17804854. | VAR_031575 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| AK023045 mRNA. Translation: BAB14371.1. AC083862 Genomic DNA. No translation available. AC083870 Genomic DNA. No translation available. AC090497 Genomic DNA. No translation available. BC030651 mRNA. Translation: AAH30651.1. | |
| IPI | IPI00302490. IPI00303972. IPI00843995. |
| UniGene | Hs.648616 |
3D structure databases | |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | M14.026. |
PTM databases | |
| PhosphoSite | Q8NEM8. |
Genome annotation databases | |
| Ensembl | ENST00000458078; ENSP00000395969; ENSG00000146856; Homo sapiens. [Genome view] |
Organism-specific databases | |
| GeneCards | GC07P134321. |
| HGNC | HGNC:27981. AGBL3. |
| HPA | HPA020397. HPA024150. |
| PharmGKB | PA142672635. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q8NEM8. |
| OMA | KRIYRDK |
| OrthoDB | EOG9QRKPV |
Gene expression databases | |
| ArrayExpress | Q8NEM8. |
| Bgee | Q8NEM8. |
| CleanEx | HS_AGBL3. |
| Genevestigator | Q8NEM8. |
Family and domain databases | |
| InterPro | IPR000834. Peptidase_M14. [Graphical view] |
| Pfam | PF00246. Peptidase_M14. 1 hit. [Graphical view] |
| PROSITE | PS00132. CARBOXYPEPT_ZN_1. False negative. PS00133. CARBOXYPEPT_ZN_2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 97830. |
Entry information
| Entry name | CBPC3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NEM8 Secondary accession number(s): Q9H965 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


