Q8NEM8 (CBPC3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 63.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytosolic carboxypeptidase 3 EC=3.4.17.- Alternative name(s): ATP/GTP-binding protein-like 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1001 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Metallocarboxypeptidase that may play a role in the processing of tubulin. Ref.4 |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subcellular location | |
| Sequence similarities | Belongs to the peptidase M14 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | Metal-binding Zinc |
| Molecular function | Carboxypeptidase Hydrolase Metalloprotease Protease |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | proteolysis Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytosol Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | metallocarboxypeptidase activity Inferred from direct assay Ref.4. Source: UniProtKB zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NEM8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NEM8-2) The sequence of this isoform differs from the canonical sequence as follows: 614-621: SSRGSDSS → RELTFLLR 622-1001: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8NEM8-3) The sequence of this isoform differs from the canonical sequence as follows: 105-105: W → GVSCWSESHQAGAQWCDLGSLQPPPPRFKRFACFSLLSSRDYRRVPPRPANFVFLVETGFHHVGQDGLRLLTS 106-1001: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8NEM8-4) The sequence of this isoform differs from the canonical sequence as follows: 704-784: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1001 | 1001 | Cytosolic carboxypeptidase 3 | PRO_0000283751 | |||||
Sites | |||||||||
| Active site | 414 | 1 | Nucleophile By similarity | ||||||
| Metal binding | 364 | 1 | Zinc By similarity | ||||||
| Metal binding | 367 | 1 | Zinc By similarity | ||||||
| Metal binding | 460 | 1 | Zinc By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 733 | 1 | Phosphothreonine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 105 | 1 | W → GVSCWSESHQAGAQWCDLGS LQPPPPRFKRFACFSLLSSR DYRRVPPRPANFVFLVETGF HHVGQDGLRLLTS in isoform 3. | VSP_024370 | |||||
| Alternative sequence | 106 – 1001 | 896 | Missing in isoform 3. | VSP_024371 | |||||
| Alternative sequence | 614 – 621 | 8 | SSRGSDSS → RELTFLLR in isoform 2. | VSP_024372 | |||||
| Alternative sequence | 622 – 1001 | 380 | Missing in isoform 2. | VSP_024373 | |||||
| Alternative sequence | 704 – 784 | 81 | Missing in isoform 4. | VSP_040423 | |||||
| Natural variant | 45 | 1 | F → Y. Corresponds to variant rs2348049 [ dbSNP | Ensembl ]. | VAR_031573 | |||||
| Natural variant | 122 | 1 | E → Q. Ref.1 Ref.3 Corresponds to variant rs4236655 [ dbSNP | Ensembl ]. | VAR_031574 | |||||
| Natural variant | 360 | 1 | T → I. Corresponds to variant rs17804854 [ dbSNP | Ensembl ]. | VAR_031575 | |||||
Experimental info | |||||||||
| Sequence conflict | 210 | 1 | F → S in BAH13813. Ref.1 | ||||||
| Sequence conflict | 396 | 1 | V → A in BAH13813. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK023045 mRNA. Translation: BAB14371.1. AK302827 mRNA. Translation: BAH13813.1. AC083862 Genomic DNA. No translation available. AC083870 Genomic DNA. No translation available. AC090497 Genomic DNA. No translation available. BC030651 mRNA. Translation: AAH30651.1. |
| IPI | IPI00302490. IPI00303972. IPI00843995. IPI00921808. |
| RefSeq | NP_848658.3. NM_178563.3. |
| UniGene | Hs.648616. |
3D structure databases | |
| ProteinModelPortal | Q8NEM8. |
| ModBase | Search... |
Protein family/group databases | |
| MEROPS | M14.026. |
PTM databases | |
| PhosphoSite | Q8NEM8. |
Polymorphism databases | |
| DMDM | 143955274. |
Proteomic databases | |
| PRIDE | Q8NEM8. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000436302; ENSP00000388275; ENSG00000146856. ENST00000458078; ENSP00000395969; ENSG00000146856. |
| GeneID | 340351. |
| KEGG | hsa:340351. |
Organism-specific databases | |
| CTD | 340351. |
| GeneCards | GC07P134671. |
| HGNC | HGNC:27981. AGBL3. |
| HPA | HPA020397. HPA024150. |
| neXtProt | NX_Q8NEM8. |
| PharmGKB | PA142672635. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG15045. |
| GeneTree | ENSGT00550000074405. |
| HOGENOM | HBG506926. |
| HOVERGEN | HBG070840. |
| InParanoid | Q8NEM8. |
| OMA | WTEKTRI. |
| PhylomeDB | Q8NEM8. |
Gene expression databases | |
| ArrayExpress | Q8NEM8. |
| Bgee | Q8NEM8. |
| CleanEx | HS_AGBL3. |
| Genevestigator | Q8NEM8. |
Family and domain databases | |
| InterPro | IPR000834. Peptidase_M14. [Graphical view] |
| Pfam | PF00246. Peptidase_M14. 1 hit. [Graphical view] |
| PROSITE | PS00132. CARBOXYPEPT_ZN_1. False negative. PS00133. CARBOXYPEPT_ZN_2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 97830. |
Entry information
| Entry name | CBPC3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NEM8 Secondary accession number(s): B7Z827, Q9H965 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with