Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription factor SPT20 homolog

Gene

SUPT20H

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) activation during gastrulation. Required for down-regulation of E-cadherin during gastrulation by regulating E-cadherin protein level downstream from NCK-interacting kinase (NIK) and independently of the regulation of transcription by FGF signaling and Snail (By similarity). Required for starvation-induced ATG9A trafficking during autophagy.By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Autophagy, Gastrulation

Enzyme and pathway databases

ReactomeiR-HSA-3214847. HATs acetylate histones.

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription factor SPT20 homolog
Alternative name(s):
p38-interacting protein
Short name:
p38IP
Gene namesi
Name:SUPT20H
Synonyms:C13orf19, FAM48A
ORF Names:FP757
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:20596. SUPT20H.

Subcellular locationi

  • Nucleus 1 Publication

GO - Cellular componenti

  • SAGA complex Source: InterPro
  • SAGA-type complex Source: BHF-UCL
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134985241.

Polymorphism and mutation databases

BioMutaiSUPT20H.
DMDMi334302791.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 779779Transcription factor SPT20 homologPRO_0000187039Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei296 – 2961PhosphoserineBy similarity
Modified residuei519 – 5191PhosphoserineCombined sources
Modified residuei524 – 5241PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8NEM7.
MaxQBiQ8NEM7.
PaxDbiQ8NEM7.
PRIDEiQ8NEM7.

PTM databases

iPTMnetiQ8NEM7.
PhosphoSiteiQ8NEM7.

Expressioni

Tissue specificityi

Highly expressed in testis, moderately in brain and pituitary gland. Expressed in several fetal tissues, including lung, brain, thymus and kidney. Expression is down-regulated in malignant prostate tissues.1 Publication

Gene expression databases

BgeeiQ8NEM7.
CleanExiHS_FAM48A.
ExpressionAtlasiQ8NEM7. baseline and differential.
GenevisibleiQ8NEM7. HS.

Organism-specific databases

HPAiHPA038906.
HPA038907.

Interactioni

Subunit structurei

Interacts with MAPK14. Interacts with ATG9A.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ATG9AQ7Z3C68EBI-7568679,EBI-727146
MAPK14Q165395EBI-946984,EBI-73946

Protein-protein interaction databases

BioGridi120729. 25 interactions.
IntActiQ8NEM7. 12 interactions.
MINTiMINT-2874312.
STRINGi9606.ENSP00000218894.

Structurei

3D structure databases

ProteinModelPortaliQ8NEM7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi636 – 754119Gln-richAdd
BLAST

Sequence similaritiesi

Belongs to the SPT20 family.Curated

Phylogenomic databases

eggNOGiENOG410IJ9A. Eukaryota.
ENOG410YRYS. LUCA.
GeneTreeiENSGT00390000013549.
HOGENOMiHOG000168361.
HOVERGENiHBG081509.
InParanoidiQ8NEM7.
OMAiYFTPQQA.
OrthoDBiEOG71CFKK.
TreeFamiTF329155.

Family and domain databases

InterProiIPR021950. Spt20.
[Graphical view]
PANTHERiPTHR13526. PTHR13526. 1 hit.
PfamiPF12090. Spt20. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NEM7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQQALELALD RAEYVIESAR QRPPKRKYLS SGRKSVFQKL YDLYIEECEK
60 70 80 90 100
EPEVKKLRRN VNLLEKLVMQ ETLSCLVVNL YPGNEGYSLM LRGKNGSDSE
110 120 130 140 150
TIRLPYEEGE LLEYLDAEEL PPILVDLLEK SQVNIFHCGC VIAEIRDYRQ
160 170 180 190 200
SSNMKSPGYQ SRHILLRPTM QTLICDVHSI TSDNHKWTQE DKLLLESQLI
210 220 230 240 250
LATAEPLCLD PSIAVTCTAN RLLYNKQKMN TRPMKRCFKR YSRSSLNRQQ
260 270 280 290 300
DLSHCPPPPQ LRLLDFLQKR KERKAGQHYD LKISKAGNCV DMWKRSPCNL
310 320 330 340 350
AIPSEVDVEK YAKVEKSIKS DDSQPTVWPA HDVKDDYVFE CEAGTQYQKT
360 370 380 390 400
KLTILQSLGD PLYYGKIQPC KADEESDSQM SPSHSSTDDH SNWFIIGSKT
410 420 430 440 450
DAERVVNQYQ ELVQNEAKCP VKMSHSSSGS ASLSQVSPGK ETDQTETVSV
460 470 480 490 500
QSSVLGKGVK HRPPPIKLPS SSGNSSSGNY FTPQQTSSFL KSPTPPPSSK
510 520 530 540 550
PSSIPRKSSV DLNQVSMLSP AALSPASSSQ RTTATQVMAN SAGLNFINVV
560 570 580 590 600
GSVCGAQALM SGSNPMLGCN TGAITPAGIN LSGLLPSGGL LPNALPSAMQ
610 620 630 640 650
AASQAGVPFG LKNTSSLRPL NLLQLPGGSL IFNTLQQQQQ QLSQFTPQQP
660 670 680 690 700
QQPTTCSPQQ PGEQGSEQGS TSQEQALSAQ QAAVINLTGV GSFMQSQAAV
710 720 730 740 750
LSQLGSAENR PEQSLPQQRF QLSSAFQQQQ QQIQQLRFLQ HQMAMAAAAA
760 770
QTAQLHHHRH TGSQSKSKMK RGTPTTPKF
Length:779
Mass (Da):85,789
Last modified:May 31, 2011 - v2
Checksum:i4CD7DFD8719F621C
GO
Isoform 2 (identifier: Q8NEM7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     55-55: K → KQ
     700-732: VLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQ → AVAILAASNGYGSSSSTNSSATSSSAYRQPVKK
     733-779: Missing.

Show »
Length:733
Mass (Da):80,102
Checksum:i7FC9A980B6FF1935
GO
Isoform 3 (identifier: Q8NEM7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     531-531: R → RSGTPKPSTP...STMVTSITPG
     700-732: VLSQLGSAENRPEQSLPQQRFQLSSAFQQQQQQ → AVAILAASNGYGSSSSTNSSATSSSAYRQPVKK
     733-779: Missing.

Note: No experimental confirmation available.
Show »
Length:811
Mass (Da):88,041
Checksum:i110B9040C3B5C8A3
GO

Sequence cautioni

The sequence AAQ15220.1 differs from that shown.Intron retention.Curated
The sequence AAQ15220.1 differs from that shown. Reason: Frameshift at position 562. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti707 – 7071A → V in AAH30686 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti154 – 1541M → V.
Corresponds to variant rs7324275 [ dbSNP | Ensembl ].
VAR_055798
Natural varianti773 – 7731T → M.1 Publication
Corresponds to variant rs9469 [ dbSNP | Ensembl ].
VAR_055799

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei55 – 551K → KQ in isoform 2. 2 PublicationsVSP_014877
Alternative sequencei531 – 5311R → RSGTPKPSTPTPTPSSTPHP PDAQSSTPSTPSATPTPQDS GFTPQPTLLTQFAQQQRSLS QAMPVTTIPLSTMVTSITPG in isoform 3. 1 PublicationVSP_055621
Alternative sequencei700 – 73233VLSQL…QQQQQ → AVAILAASNGYGSSSSTNSS ATSSSAYRQPVKK in isoform 2 and isoform 3. 3 PublicationsVSP_014878Add
BLAST
Alternative sequencei733 – 77947Missing in isoform 2 and isoform 3. 3 PublicationsVSP_014879Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ130894 mRNA. Translation: CAB62207.1.
AF093250 mRNA. Translation: AAD40550.1.
AK225376 mRNA. No translation available.
AL138706, AL391383 Genomic DNA. Translation: CAI14005.1.
AL391383, AL138706 Genomic DNA. Translation: CAI15193.1.
BC030686 mRNA. Translation: AAH30686.1.
AF370384 mRNA. Translation: AAQ15220.1. Sequence problems.
CCDSiCCDS31959.1. [Q8NEM7-1]
CCDS61311.1. [Q8NEM7-3]
CCDS9362.1. [Q8NEM7-2]
RefSeqiNP_001014308.2. NM_001014286.2. [Q8NEM7-1]
NP_001265409.1. NM_001278480.1. [Q8NEM7-3]
NP_001265410.1. NM_001278481.1. [Q8NEM7-2]
NP_001265411.1. NM_001278482.1. [Q8NEM7-2]
NP_060039.1. NM_017569.3. [Q8NEM7-2]
UniGeneiHs.435815.

Genome annotation databases

EnsembliENST00000350612; ENSP00000218894; ENSG00000102710. [Q8NEM7-1]
ENST00000356185; ENSP00000348512; ENSG00000102710. [Q8NEM7-2]
ENST00000360252; ENSP00000353388; ENSG00000102710. [Q8NEM7-2]
ENST00000464744; ENSP00000419754; ENSG00000102710. [Q8NEM7-2]
ENST00000475892; ENSP00000417510; ENSG00000102710. [Q8NEM7-3]
GeneIDi55578.
KEGGihsa:55578.
UCSCiuc001uwg.4. human. [Q8NEM7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ130894 mRNA. Translation: CAB62207.1.
AF093250 mRNA. Translation: AAD40550.1.
AK225376 mRNA. No translation available.
AL138706, AL391383 Genomic DNA. Translation: CAI14005.1.
AL391383, AL138706 Genomic DNA. Translation: CAI15193.1.
BC030686 mRNA. Translation: AAH30686.1.
AF370384 mRNA. Translation: AAQ15220.1. Sequence problems.
CCDSiCCDS31959.1. [Q8NEM7-1]
CCDS61311.1. [Q8NEM7-3]
CCDS9362.1. [Q8NEM7-2]
RefSeqiNP_001014308.2. NM_001014286.2. [Q8NEM7-1]
NP_001265409.1. NM_001278480.1. [Q8NEM7-3]
NP_001265410.1. NM_001278481.1. [Q8NEM7-2]
NP_001265411.1. NM_001278482.1. [Q8NEM7-2]
NP_060039.1. NM_017569.3. [Q8NEM7-2]
UniGeneiHs.435815.

3D structure databases

ProteinModelPortaliQ8NEM7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120729. 25 interactions.
IntActiQ8NEM7. 12 interactions.
MINTiMINT-2874312.
STRINGi9606.ENSP00000218894.

PTM databases

iPTMnetiQ8NEM7.
PhosphoSiteiQ8NEM7.

Polymorphism and mutation databases

BioMutaiSUPT20H.
DMDMi334302791.

Proteomic databases

EPDiQ8NEM7.
MaxQBiQ8NEM7.
PaxDbiQ8NEM7.
PRIDEiQ8NEM7.

Protocols and materials databases

DNASUi55578.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000350612; ENSP00000218894; ENSG00000102710. [Q8NEM7-1]
ENST00000356185; ENSP00000348512; ENSG00000102710. [Q8NEM7-2]
ENST00000360252; ENSP00000353388; ENSG00000102710. [Q8NEM7-2]
ENST00000464744; ENSP00000419754; ENSG00000102710. [Q8NEM7-2]
ENST00000475892; ENSP00000417510; ENSG00000102710. [Q8NEM7-3]
GeneIDi55578.
KEGGihsa:55578.
UCSCiuc001uwg.4. human. [Q8NEM7-1]

Organism-specific databases

CTDi55578.
GeneCardsiSUPT20H.
HGNCiHGNC:20596. SUPT20H.
HPAiHPA038906.
HPA038907.
MIMi613417. gene.
neXtProtiNX_Q8NEM7.
PharmGKBiPA134985241.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJ9A. Eukaryota.
ENOG410YRYS. LUCA.
GeneTreeiENSGT00390000013549.
HOGENOMiHOG000168361.
HOVERGENiHBG081509.
InParanoidiQ8NEM7.
OMAiYFTPQQA.
OrthoDBiEOG71CFKK.
TreeFamiTF329155.

Enzyme and pathway databases

ReactomeiR-HSA-3214847. HATs acetylate histones.

Miscellaneous databases

GeneWikiiFAM48A.
GenomeRNAii55578.
PROiQ8NEM7.
SOURCEiSearch...

Gene expression databases

BgeeiQ8NEM7.
CleanExiHS_FAM48A.
ExpressionAtlasiQ8NEM7. baseline and differential.
GenevisibleiQ8NEM7. HS.

Family and domain databases

InterProiIPR021950. Spt20.
[Graphical view]
PANTHERiPTHR13526. PTHR13526. 1 hit.
PfamiPF12090. Spt20. 2 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a novel gene on chromosome 13 between BRCA2 and Rb1."
    Schmidt U., Fiedler U., Pilarsky C.P., Ehlers W., Fuessel S., Haase M., Faller G., Sauter G., Wirth M.P.
    Prostate 47:91-101(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
    Tissue: Prostate and Testis.
  2. "p38 and a p38-interacting protein are critical for downregulation of E-cadherin during mouse gastrulation."
    Zohn I.E., Li Y., Skolnik E.Y., Anderson K.V., Han J., Niswander L.
    Cell 125:957-969(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH MAPK14.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Kidney.
  4. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  6. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 445-779, VARIANT MET-773.
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-519, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  8. "Coordinated regulation of autophagy by p38alpha MAPK through mAtg9 and p38IP."
    Webber J.L., Tooze S.A.
    EMBO J. 29:27-40(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH ATG9A, SUBCELLULAR LOCATION.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSP20H_HUMAN
AccessioniPrimary (citable) accession number: Q8NEM7
Secondary accession number(s): E7ER46, Q71RF3, Q9Y6A6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: May 31, 2011
Last modified: June 8, 2016
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.