Q8NEM0 (MCPH1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Microcephalin | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 835 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Implicated in chromosome condensation and DNA damage induced cellular responses. May play a role in neurogenesis and regulation of the size of the cerebral cortex. Ref.6 Ref.7 Ref.8 |
| Subunit structure | Interacts with CDC27 and maybe other components of the APC/C complex. Interacts with histone variant H2AFX under DNA damage conditions. |
| Subcellular location | |
| Tissue specificity | Expressed in fetal brain, liver and kidney. Ref.6 |
| Domain | BRCT domain 1 is required to prevent abnormal chromosome condensation. It binds directly to the SWI-SNF chromatin remodeling complex (Ref.11). BRCT domains 2 and 3 recognize phosphoserine/phosphothreonine marks on proteins with high selectivity, and mediate interaction with phosphorylated CDC27. They also mediate the dual recognition of phosphoserine and phosphotyrosine in the C-terminal tail of histone H2AFX (Ref.12, Ref.14 and Ref.14). |
| Involvement in disease | Microcephaly, primary, 1 (MCPH1) [MIM:251200]: A disease defined as a head circumference more than 3 standard deviations below the age-related mean. Brain weight is markedly reduced and the cerebral cortex is disproportionately small. Despite this marked reduction in size, the gyral pattern is relatively well preserved, with no major abnormality in cortical architecture. Affected individuals are mentally retarded. Primary microcephaly is further defined by the absence of other syndromic features or significant neurological deficits due to degenerative brain disorder. Some MCHP1 patients also present growth retardation, short stature, and misregulated chromosome condensation as indicated by a high number of prophase-like cells detected in routine cytogenetic preparations and poor-quality metaphase G-banding. |
| Miscellaneous | MCPH1 deficient cells exhibit a delay in post-mitotic chromosome decondensation. |
| Sequence similarities | Contains 3 BRCT domains. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Mental retardation Primary microcephaly |
| Domain | Repeat |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of gene expression Inferred from electronic annotation. Source: Compara regulation of kinase activityInferred from electronic annotation. Source: Compara |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-KW microtubule organizing centerInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NEM0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NEM0-2) The sequence of this isoform differs from the canonical sequence as follows: 146-194: DDDVPILLFESNGSLIYTPTIEINSRHHSAMEKRLQEMKEKRENLSPTS → A 610-610: V → M 611-835: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 835 | 835 | Microcephalin | PRO_0000096296 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1 – 93 | 93 | BRCT 1 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 640 – 730 | 91 | BRCT 2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 751 – 833 | 83 | BRCT 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 333 | 1 | Phosphoserine Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 146 – 194 | 49 | DDDVP…LSPTS → A in isoform 2. | VSP_046135 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 610 | 1 | V → M in isoform 2. | VSP_046136 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 611 – 835 | 225 | Missing in isoform 2. | VSP_046137 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 27 | 1 | T → R in MCPH1; mild phenotype. Ref.15 | VAR_046745 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 171 | 1 | R → S. Ref.1 Ref.2 Ref.4 Ref.5 Corresponds to variant rs2442513 [ dbSNP | Ensembl ]. | VAR_046746 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 212 | 1 | A → T. Corresponds to variant rs2922828 [ dbSNP | Ensembl ]. | VAR_046747 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 264 | 1 | I → V. Corresponds to variant rs34121009 [ dbSNP | Ensembl ]. | VAR_046748 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 288 | 1 | P → H. Corresponds to variant rs35590577 [ dbSNP | Ensembl ]. | VAR_046749 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 304 | 1 | R → I. Corresponds to variant rs2083914 [ dbSNP | Ensembl ]. | VAR_046750 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 314 | 1 | D → H. Ref.2 Ref.4 Ref.5 Ref.16 Corresponds to variant rs930557 [ dbSNP | Ensembl ]. | VAR_046751 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 392 | 1 | D → G. Ref.1 Ref.2 Ref.4 Ref.5 Corresponds to variant rs2515569 [ dbSNP | Ensembl ]. | VAR_046752 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 580 | 1 | S → G. Corresponds to variant rs17076894 [ dbSNP | Ensembl ]. | VAR_046753 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 602 | 1 | L → F. Corresponds to variant rs34418490 [ dbSNP | Ensembl ]. | VAR_046754 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 682 | 1 | T → N. Corresponds to variant rs12674488 [ dbSNP | Ensembl ]. | VAR_046755 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 761 | 1 | V → A May be associated with cranial volume variation in males in a Chinese population. Ref.13 Ref.16 Corresponds to variant rs1057090 [ dbSNP | Ensembl ]. | VAR_046756 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 828 | 1 | P → S. Ref.16 Corresponds to variant rs1057091 [ dbSNP | Ensembl ]. | VAR_046757 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 5 – 8 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 10 – 16 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 25 – 34 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 49 – 54 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 57 – 66 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 69 – 71 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 73 – 82 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 88 – 90 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 96 – 99 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 649 – 654 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 657 – 670 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 674 – 678 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 683 – 690 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 695 – 702 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 706 – 709 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 711 – 719 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 726 – 728 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 731 – 733 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 736 – 746 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 748 – 750 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 755 – 758 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 762 – 764 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 772 – 781 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 786 – 789 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 790 – 792 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 794 – 798 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 809 – 811 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 813 – 822 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 828 – 831 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prostate cancer-related gene 3 (pg3) and biallelic markers thereof." Barry C., Chumakov I., Blumenfeld M. Patent number WO0114550, 01-MAR-2001 Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS SER-171 AND GLY-392. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 96-835, VARIANTS SER-171; HIS-314 AND GLY-392. Tissue: Testis. |
| [3] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS SER-171; HIS-314 AND GLY-392. Tissue: Testis. |
| [5] | Lin S.-Y., Elledge S.J. Submitted (DEC-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 96-835 (ISOFORM 1), VARIANTS SER-171; HIS-314 AND GLY-392. |
| [6] | "Identification of microcephalin, a protein implicated in determining the size of the human brain." Jackson A.P., Eastwood H., Bell S.M., Toomes C., Adu J., Carr I.M., Roberts E., Hampshire D.J., Crow Y.J., Mighell A.J., Karbani G., Jafri H., Rashid Y., Mueller R.F., Markham A.F., Woods C.G. Am. J. Hum. Genet. 71:136-142(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, INVOLVEMENT IN MCPH1. |
| [7] | "Mutations in microcephalin cause aberrant regulation of chromosome condensation." Trimborn M., Bell S.M., Felix C., Rashid Y., Jafri H., Griffiths P.D., Neumann L.M., Krebs A., Reis A., Sperling K., Neitzel H., Jackson A.P. Am. J. Hum. Genet. 75:261-266(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INVOLVEMENT IN MCPH1. |
| [8] | "Microcephalin is a DNA damage response protein involved in regulation of CHK1 and BRCA1." Xu X., Lee J., Stern D.F. J. Biol. Chem. 279:34091-34094(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [9] | "Microcephalin encodes a centrosomal protein." Zhong X., Pfeifer G.P., Xu X. Cell Cycle 5:457-458(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-333, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "A pocket on the surface of the N-terminal BRCT domain of Mcph1 is required to prevent abnormal chromosome condensation." Richards M.W., Leung J.W., Roe S.M., Li K., Chen J., Bayliss R. J. Mol. Biol. 395:908-915(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.6 ANGSTROMS) OF 1-95. |
| [12] | "Molecular basis for the association of microcephalin (MCPH1) protein with the cell division cycle protein 27 (Cdc27) subunit of the anaphase-promoting complex." Singh N., Wiltshire T.D., Thompson J.R., Mer G., Couch F.J. J. Biol. Chem. 287:2854-2862(2012) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.6 ANGSTROMS) OF 640-835 IN COMPLEX WITH PHOSPHORYLATED CDC27 PEPTIDE. |
| [13] | "Specific recognition of phosphorylated tail of H2AX by the tandem BRCT domains of MCPH1 revealed by complex structure." Shao Z., Li F., Sy S.M., Yan W., Zhang Z., Gong D., Wen B., Huen M.S., Gong Q., Wu J., Shi Y. J. Struct. Biol. 177:459-468(2012) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.95 ANGSTROMS) OF 639-835 OF MUTANT ALA-761 ALONE AND IN COMPLEX WITH H2FAX PEPTIDE. |
| [14] | "Dual recognition of phosphoserine and phosphotyrosine in histone variant H2A.X by DNA damage response protein MCPH1." Singh N., Basnet H., Wiltshire T.D., Mohammad D.H., Thompson J.R., Heroux A., Botuyan M.V., Yaffe M.B., Couch F.J., Rosenfeld M.G., Mer G. Proc. Natl. Acad. Sci. U.S.A. 109:14381-14386(2012) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 640-835. |
| [15] | "The first missense alteration in the MCPH1 gene causes autosomal recessive microcephaly with an extremely mild cellular and clinical phenotype." Trimborn M., Richter R., Sternberg N., Gavvovidis I., Schindler D., Jackson A.P., Prott E.-C., Sperling K., Gillessen-Kaesbach G., Neitzel H. Hum. Mutat. 26:496-496(2005) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT MCPH1 ARG-27. |
| [16] | "A common SNP of MCPH1 is associated with cranial volume variation in Chinese population." Wang J.-K., Li Y., Su B. Hum. Mol. Genet. 17:1329-1335(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS HIS-314; ALA-761 AND SER-828. |
| + | Additional computationally mapped references. |
Web resources
| Protein Spotlight A grey matter - Issue 64 of November 2005 |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AX087870 mRNA. Translation: CAC34661.1. AK022909 mRNA. Translation: BAB14304.1. AK301702 mRNA. Translation: BAG63174.1. AC016065 Genomic DNA. No translation available. AC018398 Genomic DNA. No translation available. AF287957 Genomic DNA. No translation available. BC030702 mRNA. Translation: AAH30702.2. BK004076 mRNA. Translation: DAA04567.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00002374. IPI00956107. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001166045.1. NM_001172574.1. NP_001166046.1. NM_001172575.1. NP_078872.2. NM_024596.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.656769. Hs.708770. Hs.721952. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q8NEM0. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | Q8NEM0. Positions 2-100, 646-834. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DIP | DIP-39802N. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q8NEM0. 4 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000342924. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q8NEM0. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 296439305. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q8NEM0. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q8NEM0. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000522905; ENSP00000430768; ENSG00000147316. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 79648. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:79648. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003wqi.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 79648. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC08P006276. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:6954. MCPH1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | CAB012177. HPA008238. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 251200. phenotype. 607117. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q8NEM0. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 2512. Autosomal recessive primary microcephaly. 52183. Premature chromosome condensation with microcephaly and intellectual deficit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA30701. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG293743. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000113501. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG052433. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q8NEM0. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4N30P1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q8NEM0. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q8NEM0. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_MCPH1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q8NEM0. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR001357. BRCT_dom. IPR022047. Microcephalin. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PANTHER | PTHR14625. PTHR14625. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00533. BRCT. 1 hit. PF12258. Microcephalin. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00292. BRCT. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF52113. BRCT. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50172. BRCT. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | MCPH1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q8NEM0. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 79648. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 68796. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | MCPH1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NEM0 Secondary accession number(s): B4DWW2 Q9H9C7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |
| Protein Spotlight Protein Spotlight articles and cited UniProtKB/Swiss-Prot entries |

Clusters with
