Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box only protein 36

Gene

FBXO36

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.By similarity

Keywordsi

Biological processUbl conjugation pathway

Names & Taxonomyi

Protein namesi
Recommended name:
F-box only protein 36
Gene namesi
Name:FBXO36
Synonyms:FBX36
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000153832.11.
HGNCiHGNC:27020. FBXO36.

Pathology & Biotechi

Organism-specific databases

DisGeNETi130888.
OpenTargetsiENSG00000153832.
PharmGKBiPA134918778.

Polymorphism and mutation databases

BioMutaiFBXO36.
DMDMi212288605.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001199281 – 188F-box only protein 36Add BLAST188

Proteomic databases

PaxDbiQ8NEA4.
PeptideAtlasiQ8NEA4.
PRIDEiQ8NEA4.

PTM databases

PhosphoSitePlusiQ8NEA4.

Expressioni

Gene expression databases

BgeeiENSG00000153832.
CleanExiHS_FBXO36.
ExpressionAtlasiQ8NEA4. baseline and differential.
GenevisibleiQ8NEA4. HS.

Organism-specific databases

HPAiHPA053865.

Interactioni

Subunit structurei

Directly interacts with SKP1 and CUL1.By similarity

Protein-protein interaction databases

BioGridi126262. 2 interactors.
STRINGi9606.ENSP00000283946.

Structurei

3D structure databases

ProteinModelPortaliQ8NEA4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini91 – 137F-boxPROSITE-ProRule annotationAdd BLAST47

Phylogenomic databases

eggNOGiENOG410IPEE. Eukaryota.
ENOG4111P01. LUCA.
GeneTreeiENSGT00390000001015.
HOGENOMiHOG000246996.
HOVERGENiHBG051577.
InParanoidiQ8NEA4.
KOiK10312.
OMAiWRWWKIS.
OrthoDBiEOG091G0PNK.
PhylomeDBiQ8NEA4.
TreeFamiTF329337.

Family and domain databases

InterProiView protein in InterPro
IPR001810. F-box_dom.
PfamiView protein in Pfam
PF00646. F-box. 1 hit.
SMARTiView protein in SMART
SM00256. FBOX. 1 hit.
SUPFAMiSSF81383. SSF81383. 1 hit.
PROSITEiView protein in PROSITE
PS50181. FBOX. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NEA4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASWLPETLF ETVGQGPPPS KDYYQLLVTR SQVIFRWWKI SLRSEYRSTK
60 70 80 90 100
PGEAKETHED FLENSHLQGQ TALIFGARIL DYVINLCKGK FDFLERLSDD
110 120 130 140 150
LLLTIISYLD LEDIARLCQT SHRFAKLCMS DKLWEQIVQS TCDTITPDVR
160 170 180
ALAEDTGWRQ LFFTNKLQLQ RQLRKRKQKY GNLREKQP
Length:188
Mass (Da):22,105
Last modified:July 22, 2008 - v2
Checksum:i3DBC55B437EB2A39
GO
Isoform 2 (identifier: Q8NEA4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MASWLPETLFETVGQGPPPSKDYYQLLVTRSQ → M

Note: No experimental confirmation available.
Show »
Length:157
Mass (Da):18,614
Checksum:i6B6C39987B78144E
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04562686L → F1 PublicationCorresponds to variant dbSNP:rs1035834Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0543361 – 32MASWL…VTRSQ → M in isoform 2. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK123085 mRNA. Translation: BAG53868.1.
AK289655 mRNA. Translation: BAF82344.1.
AC009973 Genomic DNA. Translation: AAY14756.1.
CH471063 Genomic DNA. Translation: EAW70909.1.
CH471063 Genomic DNA. Translation: EAW70912.1.
BC033935 mRNA. Translation: AAH33935.1.
CCDSiCCDS2472.1. [Q8NEA4-1]
RefSeqiNP_777559.3. NM_174899.4. [Q8NEA4-1]
UniGeneiHs.140666.

Genome annotation databases

EnsembliENST00000283946; ENSP00000283946; ENSG00000153832. [Q8NEA4-1]
ENST00000373652; ENSP00000362756; ENSG00000153832. [Q8NEA4-3]
GeneIDi130888.
KEGGihsa:130888.
UCSCiuc002vqa.4. human. [Q8NEA4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiFBX36_HUMAN
AccessioniPrimary (citable) accession number: Q8NEA4
Secondary accession number(s): B3KVQ6, Q53TE6, Q8WWD4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 22, 2008
Last modified: September 27, 2017
This is version 111 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot