Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

F-box only protein 36

Gene

FBXO36

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Names & Taxonomyi

Protein namesi
Recommended name:
F-box only protein 36
Gene namesi
Name:FBXO36
Synonyms:FBX36
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:27020. FBXO36.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134918778.

Polymorphism and mutation databases

BioMutaiFBXO36.
DMDMi212288605.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 188188F-box only protein 36PRO_0000119928Add
BLAST

Proteomic databases

PaxDbiQ8NEA4.
PeptideAtlasiQ8NEA4.
PRIDEiQ8NEA4.

PTM databases

PhosphoSiteiQ8NEA4.

Expressioni

Gene expression databases

BgeeiQ8NEA4.
CleanExiHS_FBXO36.
ExpressionAtlasiQ8NEA4. baseline and differential.
GenevisibleiQ8NEA4. HS.

Interactioni

Subunit structurei

Directly interacts with SKP1 and CUL1.By similarity

Protein-protein interaction databases

BioGridi126262. 2 interactions.
STRINGi9606.ENSP00000283946.

Structurei

3D structure databases

ProteinModelPortaliQ8NEA4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini91 – 13747F-boxPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 F-box domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IPEE. Eukaryota.
ENOG4111P01. LUCA.
GeneTreeiENSGT00390000001015.
HOGENOMiHOG000246996.
HOVERGENiHBG051577.
InParanoidiQ8NEA4.
KOiK10312.
OMAiWRWWKIS.
OrthoDBiEOG74BJV3.
PhylomeDBiQ8NEA4.
TreeFamiTF329337.

Family and domain databases

InterProiIPR001810. F-box_dom.
[Graphical view]
PfamiPF00646. F-box. 1 hit.
[Graphical view]
SMARTiSM00256. FBOX. 1 hit.
[Graphical view]
SUPFAMiSSF81383. SSF81383. 1 hit.
PROSITEiPS50181. FBOX. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NEA4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASWLPETLF ETVGQGPPPS KDYYQLLVTR SQVIFRWWKI SLRSEYRSTK
60 70 80 90 100
PGEAKETHED FLENSHLQGQ TALIFGARIL DYVINLCKGK FDFLERLSDD
110 120 130 140 150
LLLTIISYLD LEDIARLCQT SHRFAKLCMS DKLWEQIVQS TCDTITPDVR
160 170 180
ALAEDTGWRQ LFFTNKLQLQ RQLRKRKQKY GNLREKQP
Length:188
Mass (Da):22,105
Last modified:July 22, 2008 - v2
Checksum:i3DBC55B437EB2A39
GO
Isoform 2 (identifier: Q8NEA4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MASWLPETLFETVGQGPPPSKDYYQLLVTRSQ → M

Note: No experimental confirmation available.
Show »
Length:157
Mass (Da):18,614
Checksum:i6B6C39987B78144E
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti86 – 861L → F.1 Publication
Corresponds to variant rs1035834 [ dbSNP | Ensembl ].
VAR_045626

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3232MASWL…VTRSQ → M in isoform 2. 1 PublicationVSP_054336Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK123085 mRNA. Translation: BAG53868.1.
AK289655 mRNA. Translation: BAF82344.1.
AC009973 Genomic DNA. Translation: AAY14756.1.
CH471063 Genomic DNA. Translation: EAW70909.1.
CH471063 Genomic DNA. Translation: EAW70912.1.
BC033935 mRNA. Translation: AAH33935.1.
CCDSiCCDS2472.1. [Q8NEA4-1]
RefSeqiNP_777559.3. NM_174899.4. [Q8NEA4-1]
UniGeneiHs.140666.

Genome annotation databases

EnsembliENST00000283946; ENSP00000283946; ENSG00000153832. [Q8NEA4-1]
ENST00000373652; ENSP00000362756; ENSG00000153832. [Q8NEA4-3]
GeneIDi130888.
KEGGihsa:130888.
UCSCiuc002vqa.4. human. [Q8NEA4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK123085 mRNA. Translation: BAG53868.1.
AK289655 mRNA. Translation: BAF82344.1.
AC009973 Genomic DNA. Translation: AAY14756.1.
CH471063 Genomic DNA. Translation: EAW70909.1.
CH471063 Genomic DNA. Translation: EAW70912.1.
BC033935 mRNA. Translation: AAH33935.1.
CCDSiCCDS2472.1. [Q8NEA4-1]
RefSeqiNP_777559.3. NM_174899.4. [Q8NEA4-1]
UniGeneiHs.140666.

3D structure databases

ProteinModelPortaliQ8NEA4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126262. 2 interactions.
STRINGi9606.ENSP00000283946.

PTM databases

PhosphoSiteiQ8NEA4.

Polymorphism and mutation databases

BioMutaiFBXO36.
DMDMi212288605.

Proteomic databases

PaxDbiQ8NEA4.
PeptideAtlasiQ8NEA4.
PRIDEiQ8NEA4.

Protocols and materials databases

DNASUi130888.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000283946; ENSP00000283946; ENSG00000153832. [Q8NEA4-1]
ENST00000373652; ENSP00000362756; ENSG00000153832. [Q8NEA4-3]
GeneIDi130888.
KEGGihsa:130888.
UCSCiuc002vqa.4. human. [Q8NEA4-1]

Organism-specific databases

CTDi130888.
GeneCardsiFBXO36.
HGNCiHGNC:27020. FBXO36.
MIMi609105. gene.
neXtProtiNX_Q8NEA4.
PharmGKBiPA134918778.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IPEE. Eukaryota.
ENOG4111P01. LUCA.
GeneTreeiENSGT00390000001015.
HOGENOMiHOG000246996.
HOVERGENiHBG051577.
InParanoidiQ8NEA4.
KOiK10312.
OMAiWRWWKIS.
OrthoDBiEOG74BJV3.
PhylomeDBiQ8NEA4.
TreeFamiTF329337.

Miscellaneous databases

ChiTaRSiFBXO36. human.
GenomeRNAii130888.
PROiQ8NEA4.
SOURCEiSearch...

Gene expression databases

BgeeiQ8NEA4.
CleanExiHS_FBXO36.
ExpressionAtlasiQ8NEA4. baseline and differential.
GenevisibleiQ8NEA4. HS.

Family and domain databases

InterProiIPR001810. F-box_dom.
[Graphical view]
PfamiPF00646. F-box. 1 hit.
[Graphical view]
SMARTiSM00256. FBOX. 1 hit.
[Graphical view]
SUPFAMiSSF81383. SSF81383. 1 hit.
PROSITEiPS50181. FBOX. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Amygdala.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PHE-86.
    Tissue: Testis.

Entry informationi

Entry nameiFBX36_HUMAN
AccessioniPrimary (citable) accession number: Q8NEA4
Secondary accession number(s): B3KVQ6, Q53TE6, Q8WWD4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: July 22, 2008
Last modified: July 6, 2016
This is version 105 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.