Q8NE86 (MCU_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcium uniporter protein, mitochondrial Alternative name(s): Coiled-coil domain-containing protein 109A | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 351 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondrion. Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways. Regulates glucose-dependent insulin secretion in pancreatic beta-cells by regulating mitochondrial calcium uptake. Involved in buffering the amplitude of systolic calcium rises in cardiomyocytes. Ref.6 Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 |
| Subunit structure | Homooligomer. Interacts with MICU1; MICU1 acts as an essential gatekeeper for MCU. Interacts with CCDC90A/MCUR1; interaction with MICU1 and CCDC90A/MCUR1 are mutually exclusive. Ref.7 Ref.8 Ref.10 |
| Subcellular location | Mitochondrion inner membrane; Multi-pass membrane protein Ref.6 Ref.7. |
| Sequence similarities | Belongs to the MCU family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NE86-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NE86-2) The sequence of this isoform differs from the canonical sequence as follows: 166-219: DLLSHENAAT...LKEQLAPLEK → VEMGFCHVGQNGFELLTSSYLPASASQSAEIIA | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8NE86-3) The sequence of this isoform differs from the canonical sequence as follows: 1-50: MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRT → M |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 351 | 351 | Calcium uniporter protein, mitochondrial | PRO_0000282976 | |||||
Regions | |||||||||
| Topological domain | 1 – 233 | 233 | Mitochondrial matrix Potential | ||||||
| Transmembrane | 234 – 256 | 23 | Helical; Potential | ||||||
| Topological domain | 257 – 265 | 9 | Mitochondrial intermembrane Potential | ||||||
| Transmembrane | 266 – 283 | 18 | Helical; Potential | ||||||
| Topological domain | 284 – 351 | 68 | Mitochondrial matrix Potential | ||||||
| Coiled coil | 192 – 223 | 32 | Potential | ||||||
| Coiled coil | 311 – 339 | 29 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 50 | 50 | MAAAA…QHHRT → M in isoform 3. | VSP_041687 | |||||
| Alternative sequence | 166 – 219 | 54 | DLLSH…APLEK → VEMGFCHVGQNGFELLTSSY LPASASQSAEIIA in isoform 2. | VSP_024263 | |||||
Experimental info | |||||||||
| Mutagenesis | 257 | 1 | E → A: Inhibits calcium uptake. Ref.7 | ||||||
| Mutagenesis | 259 | 1 | S → A: Does not inhibit calcium uptake. Ref.7 | ||||||
| Mutagenesis | 261 | 1 | D → A: Inhibits calcium uptake. Inhibits calcium channel activity; when associated with Q-264. Ref.6 Ref.7 | ||||||
| Mutagenesis | 264 | 1 | E → A: Inhibits calcium uptake. Inhibits calcium channel activity; when associated with Q-261. Ref.6 Ref.7 | ||||||
| Sequence conflict | 107 | 1 | S → P in BAG37900. Ref.1 | ||||||
| Sequence conflict | 142 | 1 | D → Y in BAG37900. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Testis and Tongue. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Eye and Testis. |
| [5] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [6] | "A forty-kilodalton protein of the inner membrane is the mitochondrial calcium uniporter." De Stefani D., Raffaello A., Teardo E., Szabo I., Rizzuto R. Nature 476:336-340(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF ASP-261 AND GLU-264, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [7] | "Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter." Baughman J.M., Perocchi F., Girgis H.S., Plovanich M., Belcher-Timme C.A., Sancak Y., Bao X.R., Strittmatter L., Goldberger O., Bogorad R.L., Koteliansky V., Mootha V.K. Nature 476:341-345(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, OLIGOMERIZATION, INTERACTION WITH MICU1, MUTAGENESIS OF GLU-257; SER-259; ASP-261 AND GLU-264, SUBCELLULAR LOCATION. |
| [8] | "MICU1 is an essential gatekeeper for MCU-mediated mitochondrial Ca(2+) uptake that regulates cell survival." Mallilankaraman K., Doonan P., Cardenas C., Chandramoorthy H.C., Muller M., Miller R., Hoffman N.E., Gandhirajan R.K., Molgo J., Birnbaum M.J., Rothberg B.S., Mak D.O., Foskett J.K., Madesh M. Cell 151:630-644(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MICU1. |
| [9] | "Mitochondrial Ca2+ uptake 1 (MICU1) and mitochondrial ca2+ uniporter (MCU) contribute to metabolism-secretion coupling in clonal pancreatic beta-cells." Alam M.R., Groschner L.N., Parichatikanond W., Kuo L., Bondarenko A.I., Rost R., Waldeck-Weiermair M., Malli R., Graier W.F. J. Biol. Chem. 287:34445-34454(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [10] | "MCUR1 is an essential component of mitochondrial Ca(2+) uptake that regulates cellular metabolism." Mallilankaraman K., Cardenas C., Doonan P.J., Chandramoorthy H.C., Irrinki K.M., Golenar T., Csordas G., Madireddi P., Yang J., Muller M., Miller R., Kolesar J.E., Molgo J., Kaufman B., Hajnoczky G., Foskett J.K., Madesh M. Nat. Cell Biol. 14:1336-1343(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CCDC90A AND MICU1. |
| [11] | "The mitochondrial Ca2+ uniporter MCU is essential for glucose-induced ATP increases in pancreatic beta-cells." Tarasov A.I., Semplici F., Ravier M.A., Bellomo E.A., Pullen T.J., Gilon P., Sekler I., Rizzuto R., Rutter G.A. PLoS ONE 7:E39722-E39722(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [12] | "Mitochondrial Ca2+ uptake contributes to buffering cytoplasmic Ca2+ peaks in cardiomyocytes." Drago I., De Stefani D., Rizzuto R., Pozzan T. Proc. Natl. Acad. Sci. U.S.A. 109:12986-12991(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [13] | "Evolutionary diversity of the mitochondrial calcium uniporter." Bick A.G., Calvo S.E., Mootha V.K. Science 336:886-886(2012) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK315519 mRNA. Translation: BAG37900.1. AK128016 mRNA. Translation: BAG54619.1. AC016542 Genomic DNA. No translation available. AC069548 Genomic DNA. No translation available. CH471083 Genomic DNA. Translation: EAW54461.1. BC010682 mRNA. Translation: AAH10682.1. BC034235 mRNA. Translation: AAH34235.1. |
| IPI | IPI00171573. IPI00185975. IPI01011042. |
| RefSeq | NP_001257608.1. NM_001270679.1. NP_001257609.1. NM_001270680.1. NP_612366.1. NM_138357.2. |
| UniGene | Hs.591366. |
3D structure databases | |
| ProteinModelPortal | Q8NE86. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000362144. |
PTM databases | |
| PhosphoSite | Q8NE86. |
Polymorphism databases | |
| DMDM | 74730222. |
Proteomic databases | |
| PaxDb | Q8NE86. |
| PeptideAtlas | Q8NE86. |
| PRIDE | Q8NE86. |
Protocols and materials databases | |
| DNASU | 90550. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000357157; ENSP00000349680; ENSG00000156026. ENST00000373053; ENSP00000362144; ENSG00000156026. ENST00000536019; ENSP00000440913; ENSG00000156026. |
| GeneID | 90550. |
| KEGG | hsa:90550. |
| UCSC | uc001jtc.3. human. uc001jtd.3. human. uc009xqr.3. human. |
Organism-specific databases | |
| CTD | 90550. |
| GeneCards | GC10P074452. |
| HGNC | HGNC:23526. MCU. |
| HPA | HPA016480. |
| MIM | 614197. gene. |
| neXtProt | NX_Q8NE86. |
| PharmGKB | PA134888841. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG243091. |
| HOGENOM | HOG000008081. |
| HOVERGEN | HBG060246. |
| InParanoid | Q8NE86. |
| OMA | TLRIEEH. |
| OrthoDB | EOG4Z8XX3. |
| PhylomeDB | Q8NE86. |
Gene expression databases | |
| Bgee | Q8NE86. |
| CleanEx | HS_CCDC109A. |
| Genevestigator | Q8NE86. |
Family and domain databases | |
| InterPro | IPR006769. Coiled-coil-dom_prot_109_C. [Graphical view] |
| Pfam | PF04678. DUF607. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MCU. human. |
| GenomeRNAi | 90550. |
| NextBio | 76829. |
| SOURCE | Search... |
Entry information
| Entry name | MCU_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NE86 Secondary accession number(s): B2RDF3, B3KXV7, Q96FL3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
