Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NE86

- MCU_HUMAN

UniProt

Q8NE86 - MCU_HUMAN

Protein

Calcium uniporter protein, mitochondrial

Gene

MCU

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 92 (01 Oct 2014)
      Sequence version 1 (01 Oct 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Mitochondrial inner membrane calcium uniporter that mediates calcium uptake into mitochondria. Mitochondrial calcium homeostasis plays key roles in cellular physiology and regulates cell bioenergetics, cytoplasmic calcium signals and activation of cell death pathways. Activity is regulated by MICU1 and MICU2 that stimulate and inhibit MCU activity, respectively. Regulates glucose-dependent insulin secretion in pancreatic beta-cells by regulating mitochondrial calcium uptake. Involved in buffering the amplitude of systolic calcium rises in cardiomyocytes.9 Publications

    GO - Molecular functioni

    1. calcium channel activity Source: UniProtKB
    2. protein binding Source: UniProtKB
    3. uniporter activity Source: UniProtKB

    GO - Biological processi

    1. calcium ion transmembrane import into mitochondrion Source: MGI
    2. calcium-mediated signaling Source: UniProtKB
    3. glucose homeostasis Source: UniProtKB
    4. mitochondrial calcium ion transport Source: UniProtKB
    5. positive regulation of insulin secretion Source: UniProtKB
    6. positive regulation of mitochondrial calcium ion concentration Source: UniProtKB
    7. protein complex oligomerization Source: UniProtKB

    Keywords - Molecular functioni

    Calcium channel, Ion channel

    Keywords - Biological processi

    Calcium transport, Ion transport, Transport

    Keywords - Ligandi

    Calcium

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Calcium uniporter protein, mitochondrial
    Alternative name(s):
    Coiled-coil domain-containing protein 109A
    Gene namesi
    Name:MCU
    Synonyms:C10orf42, CCDC109A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:23526. MCU.

    Subcellular locationi

    Mitochondrion inner membrane 3 Publications; Multi-pass membrane protein 3 Publications

    GO - Cellular componenti

    1. calcium channel complex Source: UniProtKB
    2. integral component of mitochondrial inner membrane Source: UniProtKB
    3. mitochondrial inner membrane Source: UniProtKB
    4. uniplex complex Source: UniProtKB

    Keywords - Cellular componenti

    Membrane, Mitochondrion, Mitochondrion inner membrane

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi257 – 2571E → A: Inhibits calcium uptake. 1 Publication
    Mutagenesisi259 – 2591S → A: Does not inhibit calcium uptake. 1 Publication
    Mutagenesisi261 – 2611D → A: Inhibits calcium uptake. Inhibits calcium channel activity; when associated with Q-264. 2 Publications
    Mutagenesisi264 – 2641E → A: Inhibits calcium uptake. Inhibits calcium channel activity; when associated with Q-261. 2 Publications

    Organism-specific databases

    PharmGKBiPA134888841.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 351351Calcium uniporter protein, mitochondrialPRO_0000282976Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei332 – 3321N6-acetyllysineBy similarity

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ8NE86.
    PaxDbiQ8NE86.
    PeptideAtlasiQ8NE86.
    PRIDEiQ8NE86.

    PTM databases

    PhosphoSiteiQ8NE86.

    Expressioni

    Gene expression databases

    BgeeiQ8NE86.
    CleanExiHS_CCDC109A.
    GenevestigatoriQ8NE86.

    Organism-specific databases

    HPAiHPA016480.

    Interactioni

    Subunit structurei

    Component of the uniplex complex, composed of MCU, MCUB, MICU1, MICU2 and EMRE/SMDT1. Heterotetramer with CCDC109B/MCUB; this inhibits channel activity By similarity. Homotetramer. Interacts with MICU1; MICU1 acts as an essential regulator for MCU. Interacts with MCUR1; interaction with MICU1 and MCUR1 are mutually exclusive.By similarity5 Publications

    Protein-protein interaction databases

    BioGridi124733. 7 interactions.
    DIPiDIP-60468N.
    IntActiQ8NE86. 2 interactions.
    MINTiMINT-8051705.
    STRINGi9606.ENSP00000362144.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NE86.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 233233Mitochondrial matrixSequence AnalysisAdd
    BLAST
    Topological domaini257 – 2659Mitochondrial intermembraneSequence Analysis
    Topological domaini284 – 35168Mitochondrial matrixSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei234 – 25623HelicalSequence AnalysisAdd
    BLAST
    Transmembranei266 – 28318HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili192 – 22332Sequence AnalysisAdd
    BLAST
    Coiled coili311 – 33929Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the MCU family.Curated

    Keywords - Domaini

    Coiled coil, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG243091.
    HOGENOMiHOG000008081.
    HOVERGENiHBG060246.
    InParanoidiQ8NE86.
    OMAiKTRFDLE.
    OrthoDBiEOG7HF1JN.
    PhylomeDBiQ8NE86.
    TreeFamiTF314435.

    Family and domain databases

    InterProiIPR006769. Coiled-coil-dom_prot_109_C.
    [Graphical view]
    PfamiPF04678. DUF607. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NE86-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAAAGRSLL LLLSSRGGGG GGAGGCGALT AGCFPGLGVS RHRQQQHHRT    50
    VHQRIASWQN LGAVYCSTVV PSDDVTVVYQ NGLPVISVRL PSRRERCQFT 100
    LKPISDSVGV FLRQLQEEDR GIDRVAIYSP DGVRVAASTG IDLLLLDDFK 150
    LVINDLTYHV RPPKRDLLSH ENAATLNDVK TLVQQLYTTL CIEQHQLNKE 200
    RELIERLEDL KEQLAPLEKV RIEISRKAEK RTTLVLWGGL AYMATQFGIL 250
    ARLTWWEYSW DIMEPVTYFI TYGSAMAMYA YFVMTRQEYV YPEARDRQYL 300
    LFFHKGAKKS RFDLEKYNQL KDAIAQAEMD LKRLRDPLQV HLPLRQIGEK 350
    D 351
    Length:351
    Mass (Da):39,867
    Last modified:October 1, 2002 - v1
    Checksum:i50205D01055D66E4
    GO
    Isoform 2 (identifier: Q8NE86-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         166-219: DLLSHENAAT...LKEQLAPLEK → VEMGFCHVGQNGFELLTSSYLPASASQSAEIIA

    Note: No experimental confirmation available.

    Show »
    Length:330
    Mass (Da):36,996
    Checksum:i56D458541240604A
    GO
    Isoform 3 (identifier: Q8NE86-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-50: MAAAAGRSLLLLLSSRGGGGGGAGGCGALTAGCFPGLGVSRHRQQQHHRT → M

    Show »
    Length:302
    Mass (Da):35,159
    Checksum:i65C6D99CD9D2D3FC
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti107 – 1071S → P in BAG37900. (PubMed:14702039)Curated
    Sequence conflicti142 – 1421D → Y in BAG37900. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5050MAAAA…QHHRT → M in isoform 3. 1 PublicationVSP_041687Add
    BLAST
    Alternative sequencei166 – 21954DLLSH…APLEK → VEMGFCHVGQNGFELLTSSY LPASASQSAEIIA in isoform 2. 1 PublicationVSP_024263Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK315519 mRNA. Translation: BAG37900.1.
    AK128016 mRNA. Translation: BAG54619.1.
    AC016542 Genomic DNA. No translation available.
    AC069548 Genomic DNA. No translation available.
    CH471083 Genomic DNA. Translation: EAW54461.1.
    BC010682 mRNA. Translation: AAH10682.1.
    BC034235 mRNA. Translation: AAH34235.1.
    CCDSiCCDS59218.1. [Q8NE86-2]
    CCDS59219.1. [Q8NE86-3]
    CCDS7317.1. [Q8NE86-1]
    RefSeqiNP_001257608.1. NM_001270679.1. [Q8NE86-2]
    NP_001257609.1. NM_001270680.1. [Q8NE86-3]
    NP_612366.1. NM_138357.2. [Q8NE86-1]
    UniGeneiHs.591366.

    Genome annotation databases

    EnsembliENST00000357157; ENSP00000349680; ENSG00000156026. [Q8NE86-2]
    ENST00000373053; ENSP00000362144; ENSG00000156026. [Q8NE86-1]
    ENST00000536019; ENSP00000440913; ENSG00000156026. [Q8NE86-3]
    GeneIDi90550.
    KEGGihsa:90550.
    UCSCiuc001jtc.3. human. [Q8NE86-1]
    uc001jtd.3. human. [Q8NE86-3]
    uc009xqr.3. human. [Q8NE86-2]

    Polymorphism databases

    DMDMi74730222.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK315519 mRNA. Translation: BAG37900.1 .
    AK128016 mRNA. Translation: BAG54619.1 .
    AC016542 Genomic DNA. No translation available.
    AC069548 Genomic DNA. No translation available.
    CH471083 Genomic DNA. Translation: EAW54461.1 .
    BC010682 mRNA. Translation: AAH10682.1 .
    BC034235 mRNA. Translation: AAH34235.1 .
    CCDSi CCDS59218.1. [Q8NE86-2 ]
    CCDS59219.1. [Q8NE86-3 ]
    CCDS7317.1. [Q8NE86-1 ]
    RefSeqi NP_001257608.1. NM_001270679.1. [Q8NE86-2 ]
    NP_001257609.1. NM_001270680.1. [Q8NE86-3 ]
    NP_612366.1. NM_138357.2. [Q8NE86-1 ]
    UniGenei Hs.591366.

    3D structure databases

    ProteinModelPortali Q8NE86.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124733. 7 interactions.
    DIPi DIP-60468N.
    IntActi Q8NE86. 2 interactions.
    MINTi MINT-8051705.
    STRINGi 9606.ENSP00000362144.

    PTM databases

    PhosphoSitei Q8NE86.

    Polymorphism databases

    DMDMi 74730222.

    Proteomic databases

    MaxQBi Q8NE86.
    PaxDbi Q8NE86.
    PeptideAtlasi Q8NE86.
    PRIDEi Q8NE86.

    Protocols and materials databases

    DNASUi 90550.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000357157 ; ENSP00000349680 ; ENSG00000156026 . [Q8NE86-2 ]
    ENST00000373053 ; ENSP00000362144 ; ENSG00000156026 . [Q8NE86-1 ]
    ENST00000536019 ; ENSP00000440913 ; ENSG00000156026 . [Q8NE86-3 ]
    GeneIDi 90550.
    KEGGi hsa:90550.
    UCSCi uc001jtc.3. human. [Q8NE86-1 ]
    uc001jtd.3. human. [Q8NE86-3 ]
    uc009xqr.3. human. [Q8NE86-2 ]

    Organism-specific databases

    CTDi 90550.
    GeneCardsi GC10P074452.
    HGNCi HGNC:23526. MCU.
    HPAi HPA016480.
    MIMi 614197. gene.
    neXtProti NX_Q8NE86.
    PharmGKBi PA134888841.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG243091.
    HOGENOMi HOG000008081.
    HOVERGENi HBG060246.
    InParanoidi Q8NE86.
    OMAi KTRFDLE.
    OrthoDBi EOG7HF1JN.
    PhylomeDBi Q8NE86.
    TreeFami TF314435.

    Miscellaneous databases

    ChiTaRSi MCU. human.
    GenomeRNAii 90550.
    NextBioi 76829.
    PROi Q8NE86.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8NE86.
    CleanExi HS_CCDC109A.
    Genevestigatori Q8NE86.

    Family and domain databases

    InterProi IPR006769. Coiled-coil-dom_prot_109_C.
    [Graphical view ]
    Pfami PF04678. DUF607. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Testis and Tongue.
    2. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Eye and Testis.
    5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    6. "A forty-kilodalton protein of the inner membrane is the mitochondrial calcium uniporter."
      De Stefani D., Raffaello A., Teardo E., Szabo I., Rizzuto R.
      Nature 476:336-340(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, MUTAGENESIS OF ASP-261 AND GLU-264, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    7. "Integrative genomics identifies MCU as an essential component of the mitochondrial calcium uniporter."
      Baughman J.M., Perocchi F., Girgis H.S., Plovanich M., Belcher-Timme C.A., Sancak Y., Bao X.R., Strittmatter L., Goldberger O., Bogorad R.L., Koteliansky V., Mootha V.K.
      Nature 476:341-345(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, OLIGOMERIZATION, INTERACTION WITH MICU1, MUTAGENESIS OF GLU-257; SER-259; ASP-261 AND GLU-264, SUBCELLULAR LOCATION.
    8. "MICU1 is an essential gatekeeper for MCU-mediated mitochondrial Ca(2+) uptake that regulates cell survival."
      Mallilankaraman K., Doonan P., Cardenas C., Chandramoorthy H.C., Muller M., Miller R., Hoffman N.E., Gandhirajan R.K., Molgo J., Birnbaum M.J., Rothberg B.S., Mak D.O., Foskett J.K., Madesh M.
      Cell 151:630-644(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH MICU1.
    9. "Mitochondrial Ca2+ uptake 1 (MICU1) and mitochondrial ca2+ uniporter (MCU) contribute to metabolism-secretion coupling in clonal pancreatic beta-cells."
      Alam M.R., Groschner L.N., Parichatikanond W., Kuo L., Bondarenko A.I., Rost R., Waldeck-Weiermair M., Malli R., Graier W.F.
      J. Biol. Chem. 287:34445-34454(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    10. Cited for: FUNCTION, INTERACTION WITH MCUR1 AND MICU1.
    11. "The mitochondrial Ca2+ uniporter MCU is essential for glucose-induced ATP increases in pancreatic beta-cells."
      Tarasov A.I., Semplici F., Ravier M.A., Bellomo E.A., Pullen T.J., Gilon P., Sekler I., Rizzuto R., Rutter G.A.
      PLoS ONE 7:E39722-E39722(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    12. "Mitochondrial Ca2+ uptake contributes to buffering cytoplasmic Ca2+ peaks in cardiomyocytes."
      Drago I., De Stefani D., Rizzuto R., Pozzan T.
      Proc. Natl. Acad. Sci. U.S.A. 109:12986-12991(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    13. "Evolutionary diversity of the mitochondrial calcium uniporter."
      Bick A.G., Calvo S.E., Mootha V.K.
      Science 336:886-886(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.
    14. Cited for: FUNCTION, INTERACTION WITH MICU1.
    15. Cited for: SUBCELLULAR LOCATION, IDENTIFICATION IN THE UNIPLEX COMPLEX.
    16. "MICU1 and MICU2 finely tune the mitochondrial Ca(2+) uniporter by exerting opposite effects on MCU activity."
      Patron M., Checchetto V., Raffaello A., Teardo E., Vecellio Reane D., Mantoan M., Granatiero V., Szabo I., De Stefani D., Rizzuto R.
      Mol. Cell 53:726-737(2014) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.

    Entry informationi

    Entry nameiMCU_HUMAN
    AccessioniPrimary (citable) accession number: Q8NE86
    Secondary accession number(s): B2RDF3, B3KXV7, Q96FL3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 3, 2007
    Last sequence update: October 1, 2002
    Last modified: October 1, 2014
    This is version 92 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3