Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Metal transporter CNNM3

Gene

CNNM3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable metal transporter.By similarity

Miscellaneous

Shares weak sequence similarity with the cyclin family, hence its name. However, it has no cyclin-like function in vivo.

GO - Biological processi

Keywordsi

Biological processIon transport, Transport

Protein family/group databases

TCDBi9.A.40.3.3. the hlyc/corc (hcc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Metal transporter CNNM3
Alternative name(s):
Ancient conserved domain-containing protein 3
Cyclin-M3
Gene namesi
Name:CNNM3
Synonyms:ACDP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:104. CNNM3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei11 – 27HelicalSequence analysisAdd BLAST17
Transmembranei193 – 213HelicalSequence analysisAdd BLAST21
Transmembranei221 – 241HelicalSequence analysisAdd BLAST21
Transmembranei261 – 281HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • membrane Source: UniProtKB
  • plasma membrane Source: UniProtKB-SubCell

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi26505.
OpenTargetsiENSG00000168763.
PharmGKBiPA26670.

Polymorphism and mutation databases

BioMutaiCNNM3.
DMDMi74751242.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002957631 – 707Metal transporter CNNM3Add BLAST707

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi73N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei661PhosphoserineCombined sources1
Modified residuei700PhosphoserineCombined sources1

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ8NE01.
MaxQBiQ8NE01.
PaxDbiQ8NE01.
PeptideAtlasiQ8NE01.
PRIDEiQ8NE01.
TopDownProteomicsiQ8NE01-1. [Q8NE01-1]
Q8NE01-2. [Q8NE01-2]
Q8NE01-3. [Q8NE01-3]

PTM databases

iPTMnetiQ8NE01.
PhosphoSitePlusiQ8NE01.

Expressioni

Tissue specificityi

Widely expressed. Expressed at higher level in heart and spleen.1 Publication

Gene expression databases

BgeeiENSG00000168763.
CleanExiHS_CNNM3.
GenevisibleiQ8NE01. HS.

Organism-specific databases

HPAiHPA016711.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi117712. 28 interactors.
IntActiQ8NE01. 68 interactors.
MINTiMINT-1452431.
STRINGi9606.ENSP00000305449.

Structurei

Secondary structure

1707
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni309 – 311Combined sources3
Helixi314 – 317Combined sources4
Beta strandi318 – 320Combined sources3
Helixi321 – 323Combined sources3
Helixi335 – 344Combined sources10
Beta strandi347 – 355Combined sources9
Beta strandi359 – 364Combined sources6
Helixi365 – 368Combined sources4
Beta strandi373 – 375Combined sources3
Helixi379 – 383Combined sources5
Beta strandi392 – 394Combined sources3
Helixi399 – 407Combined sources9
Beta strandi412 – 420Combined sources9
Beta strandi423 – 425Combined sources3
Beta strandi428 – 436Combined sources9
Helixi437 – 444Combined sources8

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5K22X-ray3.00B309-452[»]
5K23X-ray2.96C309-452[»]
5K25X-ray3.05C309-452[»]
5TSRX-ray3.19B/D309-452[»]
ProteinModelPortaliQ8NE01.
SMRiQ8NE01.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini137 – 288DUF21Add BLAST152
Domaini318 – 379CBS 1PROSITE-ProRule annotationAdd BLAST62
Domaini386 – 452CBS 2PROSITE-ProRule annotationAdd BLAST67

Sequence similaritiesi

Belongs to the ACDP family.Curated

Keywords - Domaini

CBS domain, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG2118. Eukaryota.
COG1253. LUCA.
GeneTreeiENSGT00390000002383.
HOGENOMiHOG000231947.
HOVERGENiHBG074775.
InParanoidiQ8NE01.
KOiK16302.
OMAiGAMELHE.
OrthoDBiEOG091G02YS.
PhylomeDBiQ8NE01.
TreeFamiTF101012.

Family and domain databases

Gene3Di2.60.120.10. 1 hit.
InterProiView protein in InterPro
IPR000644. CBS_dom.
IPR014710. RmlC-like_jellyroll.
PfamiView protein in Pfam
PF00571. CBS. 1 hit.
PROSITEiView protein in PROSITE
PS51371. CBS. 2 hits.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NE01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAVAAAGR LGWLFAALCL GNAAGEAAPG PRVLGFCLEE DGAAGAGWVR
60 70 80 90 100
GGAARDTPDA TFLLRLFGPG FANSSWSWVA PEGAGCREEA ASPAGEWRAL
110 120 130 140 150
LRLRLRAEAV RPHSALLAVR VEPGGGAAEE AAPPWALGLG AAGLLALAAL
160 170 180 190 200
ARGLQLSALA LAPAEVQVLR ESGSEAERAA ARRLEPARRW AGCALGALLL
210 220 230 240 250
LASLAQAALA VLLYRAAGQR AVPAVLGSAG LVFLVGEVVP AAVSGRWTLA
260 270 280 290 300
LAPRALGLSR LAVLLTLPVA LPVGQLLELA ARPGRLRERV LELARGGGDP
310 320 330 340 350
YSDLSKGVLR CRTVEDVLTP LEDCFMLDAS TVLDFGVLAS IMQSGHTRIP
360 370 380 390 400
VYEEERSNIV DMLYLKDLAF VDPEDCTPLS TITRFYNHPL HFVFNDTKLD
410 420 430 440 450
AVLEEFKRGK SHLAIVQKVN NEGEGDPFYE VLGLVTLEDV IEEIIRSEIL
460 470 480 490 500
DESEDYRDTV VKRKPASLMA PLKRKEEFSL FKVSDDEYKV TISPQLLLAT
510 520 530 540 550
QRFLSREVDV FSPLRISEKV LLHLLKHPSV NQEVRFDESN RLATHHYLYQ
560 570 580 590 600
RSQPVDYFIL ILQGRVEVEI GKEGLKFENG AFTYYGVSAL TVPSSVHQSP
610 620 630 640 650
VSSLQPIRHD LQPDPGDGTH SSAYCPDYTV RALSDLQLIK VTRLQYLNAL
660 670 680 690 700
LATRAQNLPQ SPENTDLQVI PGSQTRLLGE KTTTAAGSSH SRPGVPVEGS

PGRNPGV
Length:707
Mass (Da):76,119
Last modified:October 1, 2002 - v1
Checksum:i22BE4A950A8DA7F5
GO
Isoform 2 (identifier: Q8NE01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     410-457: Missing.

Show »
Length:659
Mass (Da):70,632
Checksum:iD5D6950DBB25517B
GO
Isoform 3 (identifier: Q8NE01-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     410-457: Missing.
     694-707: GVPVEGSPGRNPGV → SLPLLPRGRDSAAYSDSDLFGLSHLVSAVTAFVWP

Note: No experimental confirmation available.
Show »
Length:680
Mass (Da):73,057
Checksum:i96670B9CE30C8E47
GO

Sequence cautioni

The sequence AAF86377 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH07199 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA90891 differs from that shown. Reason: Frameshift at position 315.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti315E → Q in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti404E → Q in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti407K → M in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti482K → T in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti532Q → H in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti533E → A in BAA90891 (PubMed:14702039).Curated1
Sequence conflicti543A → V in BAA90891 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_027082410 – 457Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_027083694 – 707GVPVE…RNPGV → SLPLLPRGRDSAAYSDSDLF GLSHLVSAVTAFVWP in isoform 3. 1 PublicationAdd BLAST14

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000025 mRNA. Translation: BAA90891.1. Frameshift.
AK126847 mRNA. Translation: BAG54379.1.
AC092636 Genomic DNA. Translation: AAY14964.1.
BC007199 mRNA. Translation: AAH07199.3. Different initiation.
BC022944 mRNA. Translation: AAH22944.1.
BC037272 mRNA. Translation: AAH37272.1.
AF216965 mRNA. Translation: AAF86377.1. Different initiation.
CCDSiCCDS2025.1. [Q8NE01-1]
CCDS2026.1. [Q8NE01-2]
RefSeqiNP_060093.3. NM_017623.4. [Q8NE01-1]
NP_951060.1. NM_199078.2. [Q8NE01-2]
UniGeneiHs.711617.

Genome annotation databases

EnsembliENST00000305510; ENSP00000305449; ENSG00000168763. [Q8NE01-1]
ENST00000377060; ENSP00000366260; ENSG00000168763. [Q8NE01-2]
GeneIDi26505.
KEGGihsa:26505.
UCSCiuc002swy.4. human. [Q8NE01-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiCNNM3_HUMAN
AccessioniPrimary (citable) accession number: Q8NE01
Secondary accession number(s): B3KX67
, Q8TBV4, Q96IW4, Q9NRK4, Q9NXW6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: October 1, 2002
Last modified: June 7, 2017
This is version 139 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families