Q8NE01 (CNNM3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Metal transporter CNNM3 Alternative name(s): Ancient conserved domain-containing protein 3 Cyclin-M3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 707 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable metal transporter By similarity. |
| Subcellular location | Cell membrane; Multi-pass membrane protein By similarity. |
| Tissue specificity | Widely expressed. Expressed at higher level in heart and spleen. Ref.4 |
| Miscellaneous | Shares weak sequence similarity with the cyclin family, hence its name. However, it has no cyclin-like function in vivo. |
| Sequence similarities | Belongs to the ACDP family. Contains 2 CBS domains. Contains 1 DUF21 domain. |
| Sequence caution | The sequence AAF86377.1 differs from that shown. Reason: Erroneous initiation. The sequence AAH07199.3 differs from that shown. Reason: Erroneous initiation. The sequence BAA90891.1 differs from that shown. Reason: Frameshift at position 315. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | CBS domain Repeat Transmembrane Transmembrane helix |
| PTM | Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | ion transport Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| MDFI | Q99750 | 3 | EBI-741032,EBI-724076 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NE01-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NE01-2) The sequence of this isoform differs from the canonical sequence as follows: 410-457: Missing. | ||||||
| Isoform 3 (identifier: Q8NE01-3) The sequence of this isoform differs from the canonical sequence as follows: 410-457: Missing. 694-707: GVPVEGSPGRNPGV → SLPLLPRGRDSAAYSDSDLFGLSHLVSAVTAFVWP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 707 | 707 | Metal transporter CNNM3 | PRO_0000295763 | |||||
Regions | |||||||||
| Transmembrane | 11 – 27 | 17 | Helical; Potential | ||||||
| Transmembrane | 193 – 213 | 21 | Helical; Potential | ||||||
| Transmembrane | 221 – 241 | 21 | Helical; Potential | ||||||
| Transmembrane | 261 – 281 | 21 | Helical; Potential | ||||||
| Domain | 137 – 288 | 152 | DUF21 | ||||||
| Domain | 318 – 379 | 62 | CBS 1 | ||||||
| Domain | 386 – 452 | 67 | CBS 2 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 661 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 700 | 1 | Phosphoserine By similarity | ||||||
| Glycosylation | 73 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 410 – 457 | 48 | Missing in isoform 2 and isoform 3. | VSP_027082 | |||||
| Alternative sequence | 694 – 707 | 14 | GVPVE…RNPGV → SLPLLPRGRDSAAYSDSDLF GLSHLVSAVTAFVWP in isoform 3. | VSP_027083 | |||||
Experimental info | |||||||||
| Sequence conflict | 315 | 1 | E → Q in BAA90891. Ref.1 | ||||||
| Sequence conflict | 404 | 1 | E → Q in BAA90891. Ref.1 | ||||||
| Sequence conflict | 407 | 1 | K → M in BAA90891. Ref.1 | ||||||
| Sequence conflict | 482 | 1 | K → T in BAA90891. Ref.1 | ||||||
| Sequence conflict | 532 | 1 | Q → H in BAA90891. Ref.1 | ||||||
| Sequence conflict | 533 | 1 | E → A in BAA90891. Ref.1 | ||||||
| Sequence conflict | 543 | 1 | A → V in BAA90891. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 313-707 (ISOFORM 2). Tissue: Adipose tissue and Amygdala. |
| [2] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 275-707 (ISOFORM 3). Tissue: Adrenal cortex, Muscle and Testis. |
| [4] | "Molecular cloning and characterization of a novel gene family of four ancient conserved domain proteins (ACDP)." Wang C.-Y., Shi J.-D., Yang P., Kumar P.G., Li Q.-Z., Run Q.-G., Su Y.-C., Scott H.S., Kao K.-J., She J.-X. Gene 306:37-44(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 294-707 (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Brain. |
| [5] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [6] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [7] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-661, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK000025 mRNA. Translation: BAA90891.1. Frameshift. AK126847 mRNA. Translation: BAG54379.1. AC092636 Genomic DNA. Translation: AAY14964.1. BC007199 mRNA. Translation: AAH07199.3. Different initiation. BC022944 mRNA. Translation: AAH22944.1. BC037272 mRNA. Translation: AAH37272.1. AF216965 mRNA. Translation: AAF86377.1. Different initiation. |
| IPI | IPI00168565. IPI00386115. IPI00641658. |
| RefSeq | NP_060093.3. NM_017623.4. NP_951060.1. NM_199078.2. |
| UniGene | Hs.711617. |
3D structure databases | |
| ProteinModelPortal | Q8NE01. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8NE01. 8 interactions. |
| MINT | MINT-1452431. |
| STRING | 9606.ENSP00000305449. |
PTM databases | |
| PhosphoSite | Q8NE01. |
Polymorphism databases | |
| DMDM | 74751242. |
Proteomic databases | |
| PaxDb | Q8NE01. |
| PRIDE | Q8NE01. |
Protocols and materials databases | |
| DNASU | 26505. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000305510; ENSP00000305449; ENSG00000168763. ENST00000377060; ENSP00000366260; ENSG00000168763. |
| GeneID | 26505. |
| KEGG | hsa:26505. |
| UCSC | uc002swy.3. human. uc002swz.3. human. |
Organism-specific databases | |
| CTD | 26505. |
| GeneCards | GC02P097481. |
| H-InvDB | HIX0002282. HIX0117685. |
| HGNC | HGNC:104. CNNM3. |
| HPA | HPA016711. |
| MIM | 607804. gene. |
| neXtProt | NX_Q8NE01. |
| PharmGKB | PA26670. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG1253. |
| HOGENOM | HOG000231947. |
| HOVERGEN | HBG074775. |
| InParanoid | Q8NE01. |
| KO | K16302. |
| OMA | RRWAGCA. |
| PhylomeDB | Q8NE01. |
Gene expression databases | |
| Bgee | Q8NE01. |
| CleanEx | HS_CNNM3. |
| Genevestigator | Q8NE01. |
Family and domain databases | |
| InterPro | IPR000644. Cysta_beta_synth_core. IPR002550. DUF21. [Graphical view] |
| Pfam | PF01595. DUF21. 1 hit. [Graphical view] |
| PROSITE | PS51371. CBS. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | CNNM3. human. |
| GenomeRNAi | 26505. |
| NextBio | 48786. |
| SOURCE | Search... |
Entry information
| Entry name | CNNM3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NE01 Secondary accession number(s): B3KX67 Q9NXW6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
