Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NE01 (CNNM3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 108. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Metal transporter CNNM3
Alternative name(s):
Ancient conserved domain-containing protein 3
Cyclin-M3
Gene names
Name:CNNM3
Synonyms:ACDP3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length707 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probable metal transporter By similarity.

Subcellular location

Cell membrane; Multi-pass membrane protein By similarity.

Tissue specificity

Widely expressed. Expressed at higher level in heart and spleen. Ref.4

Miscellaneous

Shares weak sequence similarity with the cyclin family, hence its name. However, it has no cyclin-like function in vivo.

Sequence similarities

Belongs to the ACDP family.

Contains 2 CBS domains.

Contains 1 DUF21 domain.

Sequence caution

The sequence AAF86377.1 differs from that shown. Reason: Erroneous initiation.

The sequence AAH07199.3 differs from that shown. Reason: Erroneous initiation.

The sequence BAA90891.1 differs from that shown. Reason: Frameshift at position 315.

Ontologies

Binary interactions

With

Entry

#Exp.

IntAct

Notes

MDFIQ997503EBI-741032,EBI-724076

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8NE01-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8NE01-2)

The sequence of this isoform differs from the canonical sequence as follows:
     410-457: Missing.
Isoform 3 (identifier: Q8NE01-3)

The sequence of this isoform differs from the canonical sequence as follows:
     410-457: Missing.
     694-707: GVPVEGSPGRNPGV → SLPLLPRGRDSAAYSDSDLFGLSHLVSAVTAFVWP
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 707707Metal transporter CNNM3
PRO_0000295763

Regions

Transmembrane11 – 2717Helical; Potential
Transmembrane193 – 21321Helical; Potential
Transmembrane221 – 24121Helical; Potential
Transmembrane261 – 28121Helical; Potential
Domain137 – 288152DUF21
Domain318 – 37962CBS 1
Domain386 – 45267CBS 2

Amino acid modifications

Modified residue6611Phosphoserine Ref.8
Modified residue7001Phosphoserine By similarity
Glycosylation731N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence410 – 45748Missing in isoform 2 and isoform 3.
VSP_027082
Alternative sequence694 – 70714GVPVE…RNPGV → SLPLLPRGRDSAAYSDSDLF GLSHLVSAVTAFVWP in isoform 3.
VSP_027083

Experimental info

Sequence conflict3151E → Q in BAA90891. Ref.1
Sequence conflict4041E → Q in BAA90891. Ref.1
Sequence conflict4071K → M in BAA90891. Ref.1
Sequence conflict4821K → T in BAA90891. Ref.1
Sequence conflict5321Q → H in BAA90891. Ref.1
Sequence conflict5331E → A in BAA90891. Ref.1
Sequence conflict5431A → V in BAA90891. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2002. Version 1.
Checksum: 22BE4A950A8DA7F5

FASTA70776,119
        10         20         30         40         50         60 
MAAAVAAAGR LGWLFAALCL GNAAGEAAPG PRVLGFCLEE DGAAGAGWVR GGAARDTPDA 

        70         80         90        100        110        120 
TFLLRLFGPG FANSSWSWVA PEGAGCREEA ASPAGEWRAL LRLRLRAEAV RPHSALLAVR 

       130        140        150        160        170        180 
VEPGGGAAEE AAPPWALGLG AAGLLALAAL ARGLQLSALA LAPAEVQVLR ESGSEAERAA 

       190        200        210        220        230        240 
ARRLEPARRW AGCALGALLL LASLAQAALA VLLYRAAGQR AVPAVLGSAG LVFLVGEVVP 

       250        260        270        280        290        300 
AAVSGRWTLA LAPRALGLSR LAVLLTLPVA LPVGQLLELA ARPGRLRERV LELARGGGDP 

       310        320        330        340        350        360 
YSDLSKGVLR CRTVEDVLTP LEDCFMLDAS TVLDFGVLAS IMQSGHTRIP VYEEERSNIV 

       370        380        390        400        410        420 
DMLYLKDLAF VDPEDCTPLS TITRFYNHPL HFVFNDTKLD AVLEEFKRGK SHLAIVQKVN 

       430        440        450        460        470        480 
NEGEGDPFYE VLGLVTLEDV IEEIIRSEIL DESEDYRDTV VKRKPASLMA PLKRKEEFSL 

       490        500        510        520        530        540 
FKVSDDEYKV TISPQLLLAT QRFLSREVDV FSPLRISEKV LLHLLKHPSV NQEVRFDESN 

       550        560        570        580        590        600 
RLATHHYLYQ RSQPVDYFIL ILQGRVEVEI GKEGLKFENG AFTYYGVSAL TVPSSVHQSP 

       610        620        630        640        650        660 
VSSLQPIRHD LQPDPGDGTH SSAYCPDYTV RALSDLQLIK VTRLQYLNAL LATRAQNLPQ 

       670        680        690        700 
SPENTDLQVI PGSQTRLLGE KTTTAAGSSH SRPGVPVEGS PGRNPGV 

« Hide

Isoform 2 [UniParc].

Checksum: D5D6950DBB25517B
Show »

FASTA65970,632
Isoform 3 [UniParc].

Checksum: 96670B9CE30C8E47
Show »

FASTA68073,057

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 313-707 (ISOFORM 2).
Tissue: Adipose tissue and Amygdala.
[2]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 275-707 (ISOFORM 3).
Tissue: Adrenal cortex, Muscle and Testis.
[4]"Molecular cloning and characterization of a novel gene family of four ancient conserved domain proteins (ACDP)."
Wang C.-Y., Shi J.-D., Yang P., Kumar P.G., Li Q.-Z., Run Q.-G., Su Y.-C., Scott H.S., Kao K.-J., She J.-X.
Gene 306:37-44(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 294-707 (ISOFORM 1), TISSUE SPECIFICITY.
Tissue: Brain.
[5]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[6]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[8]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-661, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK000025 mRNA. Translation: BAA90891.1. Frameshift.
AK126847 mRNA. Translation: BAG54379.1.
AC092636 Genomic DNA. Translation: AAY14964.1.
BC007199 mRNA. Translation: AAH07199.3. Different initiation.
BC022944 mRNA. Translation: AAH22944.1.
BC037272 mRNA. Translation: AAH37272.1.
AF216965 mRNA. Translation: AAF86377.1. Different initiation.
CCDSCCDS2025.1. [Q8NE01-1]
CCDS2026.1. [Q8NE01-2]
RefSeqNP_060093.3. NM_017623.4. [Q8NE01-1]
NP_951060.1. NM_199078.2. [Q8NE01-2]
XP_005263975.1. XM_005263918.2. [Q8NE01-3]
UniGeneHs.711617.

3D structure databases

ProteinModelPortalQ8NE01.
SMRQ8NE01. Positions 309-452.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid117712. 16 interactions.
IntActQ8NE01. 9 interactions.
MINTMINT-1452431.
STRING9606.ENSP00000305449.

Protein family/group databases

TCDB9.A.40.3.3. the hlyc/corc (hcc) family.

PTM databases

PhosphoSiteQ8NE01.

Polymorphism databases

DMDM74751242.

Proteomic databases

MaxQBQ8NE01.
PaxDbQ8NE01.
PRIDEQ8NE01.

Protocols and materials databases

DNASU26505.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000305510; ENSP00000305449; ENSG00000168763. [Q8NE01-1]
ENST00000377060; ENSP00000366260; ENSG00000168763. [Q8NE01-2]
GeneID26505.
KEGGhsa:26505.
UCSCuc002swy.3. human. [Q8NE01-1]
uc002swz.3. human. [Q8NE01-2]

Organism-specific databases

CTD26505.
GeneCardsGC02P097481.
H-InvDBHIX0002282.
HIX0117685.
HGNCHGNC:104. CNNM3.
HPAHPA016711.
MIM607804. gene.
neXtProtNX_Q8NE01.
PharmGKBPA26670.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1253.
HOGENOMHOG000231947.
HOVERGENHBG074775.
InParanoidQ8NE01.
KOK16302.
OMAEPARRWA.
OrthoDBEOG72ZCD7.
PhylomeDBQ8NE01.
TreeFamTF101012.

Gene expression databases

BgeeQ8NE01.
CleanExHS_CNNM3.
GenevestigatorQ8NE01.

Family and domain databases

InterProIPR000644. CBS_dom.
IPR002550. DUF21.
[Graphical view]
PfamPF00571. CBS. 1 hit.
PF01595. DUF21. 1 hit.
[Graphical view]
PROSITEPS51371. CBS. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCNNM3. human.
GenomeRNAi26505.
NextBio48786.
PROQ8NE01.
SOURCESearch...

Entry information

Entry nameCNNM3_HUMAN
AccessionPrimary (citable) accession number: Q8NE01
Secondary accession number(s): B3KX67 expand/collapse secondary AC list , Q8TBV4, Q96IW4, Q9NRK4, Q9NXW6
Entry history
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: October 1, 2002
Last modified: July 9, 2014
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM