Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NE01

- CNNM3_HUMAN

UniProt

Q8NE01 - CNNM3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Metal transporter CNNM3

Gene

CNNM3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Probable metal transporter.By similarity

GO - Molecular functioni

  1. adenyl nucleotide binding Source: InterPro

GO - Biological processi

  1. ion transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Ion transport, Transport

Protein family/group databases

TCDBi9.A.40.3.3. the hlyc/corc (hcc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Metal transporter CNNM3
Alternative name(s):
Ancient conserved domain-containing protein 3
Cyclin-M3
Gene namesi
Name:CNNM3
Synonyms:ACDP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:104. CNNM3.

Subcellular locationi

Cell membrane By similarity; Multi-pass membrane protein By similarity

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. membrane Source: UniProtKB
  3. plasma membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA26670.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 707707Metal transporter CNNM3PRO_0000295763Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi73 – 731N-linked (GlcNAc...)Sequence Analysis
Modified residuei661 – 6611Phosphoserine1 Publication
Modified residuei700 – 7001PhosphoserineBy similarity

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ8NE01.
PaxDbiQ8NE01.
PRIDEiQ8NE01.

PTM databases

PhosphoSiteiQ8NE01.

Expressioni

Tissue specificityi

Widely expressed. Expressed at higher level in heart and spleen.1 Publication

Gene expression databases

BgeeiQ8NE01.
CleanExiHS_CNNM3.
GenevestigatoriQ8NE01.

Organism-specific databases

HPAiHPA016711.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
MDFIQ997503EBI-741032,EBI-724076

Protein-protein interaction databases

BioGridi117712. 16 interactions.
IntActiQ8NE01. 9 interactions.
MINTiMINT-1452431.
STRINGi9606.ENSP00000305449.

Structurei

3D structure databases

ProteinModelPortaliQ8NE01.
SMRiQ8NE01. Positions 309-452, 506-593.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei11 – 2717HelicalSequence AnalysisAdd
BLAST
Transmembranei193 – 21321HelicalSequence AnalysisAdd
BLAST
Transmembranei221 – 24121HelicalSequence AnalysisAdd
BLAST
Transmembranei261 – 28121HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini137 – 288152DUF21Add
BLAST
Domaini318 – 37962CBS 1PROSITE-ProRule annotationAdd
BLAST
Domaini386 – 45267CBS 2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the ACDP family.Curated
Contains 2 CBS domains.PROSITE-ProRule annotation
Contains 1 DUF21 domain.Curated

Keywords - Domaini

CBS domain, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1253.
GeneTreeiENSGT00390000002383.
HOGENOMiHOG000231947.
HOVERGENiHBG074775.
InParanoidiQ8NE01.
KOiK16302.
OMAiEPARRWA.
OrthoDBiEOG72ZCD7.
PhylomeDBiQ8NE01.
TreeFamiTF101012.

Family and domain databases

InterProiIPR000644. CBS_dom.
IPR002550. DUF21.
[Graphical view]
PfamiPF00571. CBS. 1 hit.
PF01595. DUF21. 1 hit.
[Graphical view]
PROSITEiPS51371. CBS. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8NE01-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAVAAAGR LGWLFAALCL GNAAGEAAPG PRVLGFCLEE DGAAGAGWVR
60 70 80 90 100
GGAARDTPDA TFLLRLFGPG FANSSWSWVA PEGAGCREEA ASPAGEWRAL
110 120 130 140 150
LRLRLRAEAV RPHSALLAVR VEPGGGAAEE AAPPWALGLG AAGLLALAAL
160 170 180 190 200
ARGLQLSALA LAPAEVQVLR ESGSEAERAA ARRLEPARRW AGCALGALLL
210 220 230 240 250
LASLAQAALA VLLYRAAGQR AVPAVLGSAG LVFLVGEVVP AAVSGRWTLA
260 270 280 290 300
LAPRALGLSR LAVLLTLPVA LPVGQLLELA ARPGRLRERV LELARGGGDP
310 320 330 340 350
YSDLSKGVLR CRTVEDVLTP LEDCFMLDAS TVLDFGVLAS IMQSGHTRIP
360 370 380 390 400
VYEEERSNIV DMLYLKDLAF VDPEDCTPLS TITRFYNHPL HFVFNDTKLD
410 420 430 440 450
AVLEEFKRGK SHLAIVQKVN NEGEGDPFYE VLGLVTLEDV IEEIIRSEIL
460 470 480 490 500
DESEDYRDTV VKRKPASLMA PLKRKEEFSL FKVSDDEYKV TISPQLLLAT
510 520 530 540 550
QRFLSREVDV FSPLRISEKV LLHLLKHPSV NQEVRFDESN RLATHHYLYQ
560 570 580 590 600
RSQPVDYFIL ILQGRVEVEI GKEGLKFENG AFTYYGVSAL TVPSSVHQSP
610 620 630 640 650
VSSLQPIRHD LQPDPGDGTH SSAYCPDYTV RALSDLQLIK VTRLQYLNAL
660 670 680 690 700
LATRAQNLPQ SPENTDLQVI PGSQTRLLGE KTTTAAGSSH SRPGVPVEGS

PGRNPGV
Length:707
Mass (Da):76,119
Last modified:October 1, 2002 - v1
Checksum:i22BE4A950A8DA7F5
GO
Isoform 2 (identifier: Q8NE01-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     410-457: Missing.

Show »
Length:659
Mass (Da):70,632
Checksum:iD5D6950DBB25517B
GO
Isoform 3 (identifier: Q8NE01-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     410-457: Missing.
     694-707: GVPVEGSPGRNPGV → SLPLLPRGRDSAAYSDSDLFGLSHLVSAVTAFVWP

Note: No experimental confirmation available.

Show »
Length:680
Mass (Da):73,057
Checksum:i96670B9CE30C8E47
GO

Sequence cautioni

The sequence BAA90891.1 differs from that shown. Reason: Frameshift at position 315.
The sequence AAF86377.1 differs from that shown. Reason: Erroneous initiation.
The sequence AAH07199.3 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti315 – 3151E → Q in BAA90891. (PubMed:14702039)Curated
Sequence conflicti404 – 4041E → Q in BAA90891. (PubMed:14702039)Curated
Sequence conflicti407 – 4071K → M in BAA90891. (PubMed:14702039)Curated
Sequence conflicti482 – 4821K → T in BAA90891. (PubMed:14702039)Curated
Sequence conflicti532 – 5321Q → H in BAA90891. (PubMed:14702039)Curated
Sequence conflicti533 – 5331E → A in BAA90891. (PubMed:14702039)Curated
Sequence conflicti543 – 5431A → V in BAA90891. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei410 – 45748Missing in isoform 2 and isoform 3. 2 PublicationsVSP_027082Add
BLAST
Alternative sequencei694 – 70714GVPVE…RNPGV → SLPLLPRGRDSAAYSDSDLF GLSHLVSAVTAFVWP in isoform 3. 1 PublicationVSP_027083Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000025 mRNA. Translation: BAA90891.1. Frameshift.
AK126847 mRNA. Translation: BAG54379.1.
AC092636 Genomic DNA. Translation: AAY14964.1.
BC007199 mRNA. Translation: AAH07199.3. Different initiation.
BC022944 mRNA. Translation: AAH22944.1.
BC037272 mRNA. Translation: AAH37272.1.
AF216965 mRNA. Translation: AAF86377.1. Different initiation.
CCDSiCCDS2025.1. [Q8NE01-1]
CCDS2026.1. [Q8NE01-2]
RefSeqiNP_060093.3. NM_017623.4. [Q8NE01-1]
NP_951060.1. NM_199078.2. [Q8NE01-2]
XP_005263975.1. XM_005263918.2. [Q8NE01-3]
UniGeneiHs.711617.

Genome annotation databases

EnsembliENST00000305510; ENSP00000305449; ENSG00000168763. [Q8NE01-1]
ENST00000377060; ENSP00000366260; ENSG00000168763. [Q8NE01-2]
GeneIDi26505.
KEGGihsa:26505.
UCSCiuc002swy.3. human. [Q8NE01-1]
uc002swz.3. human. [Q8NE01-2]

Polymorphism databases

DMDMi74751242.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000025 mRNA. Translation: BAA90891.1 . Frameshift.
AK126847 mRNA. Translation: BAG54379.1 .
AC092636 Genomic DNA. Translation: AAY14964.1 .
BC007199 mRNA. Translation: AAH07199.3 . Different initiation.
BC022944 mRNA. Translation: AAH22944.1 .
BC037272 mRNA. Translation: AAH37272.1 .
AF216965 mRNA. Translation: AAF86377.1 . Different initiation.
CCDSi CCDS2025.1. [Q8NE01-1 ]
CCDS2026.1. [Q8NE01-2 ]
RefSeqi NP_060093.3. NM_017623.4. [Q8NE01-1 ]
NP_951060.1. NM_199078.2. [Q8NE01-2 ]
XP_005263975.1. XM_005263918.2. [Q8NE01-3 ]
UniGenei Hs.711617.

3D structure databases

ProteinModelPortali Q8NE01.
SMRi Q8NE01. Positions 309-452, 506-593.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117712. 16 interactions.
IntActi Q8NE01. 9 interactions.
MINTi MINT-1452431.
STRINGi 9606.ENSP00000305449.

Protein family/group databases

TCDBi 9.A.40.3.3. the hlyc/corc (hcc) family.

PTM databases

PhosphoSitei Q8NE01.

Polymorphism databases

DMDMi 74751242.

Proteomic databases

MaxQBi Q8NE01.
PaxDbi Q8NE01.
PRIDEi Q8NE01.

Protocols and materials databases

DNASUi 26505.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000305510 ; ENSP00000305449 ; ENSG00000168763 . [Q8NE01-1 ]
ENST00000377060 ; ENSP00000366260 ; ENSG00000168763 . [Q8NE01-2 ]
GeneIDi 26505.
KEGGi hsa:26505.
UCSCi uc002swy.3. human. [Q8NE01-1 ]
uc002swz.3. human. [Q8NE01-2 ]

Organism-specific databases

CTDi 26505.
GeneCardsi GC02P097481.
H-InvDB HIX0002282.
HIX0117685.
HGNCi HGNC:104. CNNM3.
HPAi HPA016711.
MIMi 607804. gene.
neXtProti NX_Q8NE01.
PharmGKBi PA26670.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1253.
GeneTreei ENSGT00390000002383.
HOGENOMi HOG000231947.
HOVERGENi HBG074775.
InParanoidi Q8NE01.
KOi K16302.
OMAi EPARRWA.
OrthoDBi EOG72ZCD7.
PhylomeDBi Q8NE01.
TreeFami TF101012.

Miscellaneous databases

ChiTaRSi CNNM3. human.
GenomeRNAii 26505.
NextBioi 48786.
PROi Q8NE01.
SOURCEi Search...

Gene expression databases

Bgeei Q8NE01.
CleanExi HS_CNNM3.
Genevestigatori Q8NE01.

Family and domain databases

InterProi IPR000644. CBS_dom.
IPR002550. DUF21.
[Graphical view ]
Pfami PF00571. CBS. 1 hit.
PF01595. DUF21. 1 hit.
[Graphical view ]
PROSITEi PS51371. CBS. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 313-707 (ISOFORM 2).
    Tissue: Adipose tissue and Amygdala.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 275-707 (ISOFORM 3).
    Tissue: Adrenal cortex, Muscle and Testis.
  4. "Molecular cloning and characterization of a novel gene family of four ancient conserved domain proteins (ACDP)."
    Wang C.-Y., Shi J.-D., Yang P., Kumar P.G., Li Q.-Z., Run Q.-G., Su Y.-C., Scott H.S., Kao K.-J., She J.-X.
    Gene 306:37-44(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 294-707 (ISOFORM 1), TISSUE SPECIFICITY.
    Tissue: Brain.
  5. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-661, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiCNNM3_HUMAN
AccessioniPrimary (citable) accession number: Q8NE01
Secondary accession number(s): B3KX67
, Q8TBV4, Q96IW4, Q9NRK4, Q9NXW6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: October 1, 2002
Last modified: October 29, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Shares weak sequence similarity with the cyclin family, hence its name. However, it has no cyclin-like function in vivo.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3