Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NE01

- CNNM3_HUMAN

UniProt

Q8NE01 - CNNM3_HUMAN

Protein

Metal transporter CNNM3

Gene

CNNM3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 109 (01 Oct 2014)
      Sequence version 1 (01 Oct 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable metal transporter.By similarity

    GO - Molecular functioni

    1. adenyl nucleotide binding Source: InterPro
    2. protein binding Source: IntAct

    GO - Biological processi

    1. ion transport Source: UniProtKB-KW

    Keywords - Biological processi

    Ion transport, Transport

    Protein family/group databases

    TCDBi9.A.40.3.3. the hlyc/corc (hcc) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Metal transporter CNNM3
    Alternative name(s):
    Ancient conserved domain-containing protein 3
    Cyclin-M3
    Gene namesi
    Name:CNNM3
    Synonyms:ACDP3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:104. CNNM3.

    Subcellular locationi

    Cell membrane By similarity; Multi-pass membrane protein By similarity

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. membrane Source: UniProtKB
    3. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26670.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 707707Metal transporter CNNM3PRO_0000295763Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi73 – 731N-linked (GlcNAc...)Sequence Analysis
    Modified residuei661 – 6611Phosphoserine1 Publication
    Modified residuei700 – 7001PhosphoserineBy similarity

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ8NE01.
    PaxDbiQ8NE01.
    PRIDEiQ8NE01.

    PTM databases

    PhosphoSiteiQ8NE01.

    Expressioni

    Tissue specificityi

    Widely expressed. Expressed at higher level in heart and spleen.1 Publication

    Gene expression databases

    BgeeiQ8NE01.
    CleanExiHS_CNNM3.
    GenevestigatoriQ8NE01.

    Organism-specific databases

    HPAiHPA016711.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    MDFIQ997503EBI-741032,EBI-724076

    Protein-protein interaction databases

    BioGridi117712. 16 interactions.
    IntActiQ8NE01. 9 interactions.
    MINTiMINT-1452431.
    STRINGi9606.ENSP00000305449.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NE01.
    SMRiQ8NE01. Positions 309-452.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei11 – 2717HelicalSequence AnalysisAdd
    BLAST
    Transmembranei193 – 21321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei221 – 24121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei261 – 28121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini137 – 288152DUF21Add
    BLAST
    Domaini318 – 37962CBS 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini386 – 45267CBS 2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the ACDP family.Curated
    Contains 2 CBS domains.PROSITE-ProRule annotation
    Contains 1 DUF21 domain.Curated

    Keywords - Domaini

    CBS domain, Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1253.
    HOGENOMiHOG000231947.
    HOVERGENiHBG074775.
    InParanoidiQ8NE01.
    KOiK16302.
    OMAiEPARRWA.
    OrthoDBiEOG72ZCD7.
    PhylomeDBiQ8NE01.
    TreeFamiTF101012.

    Family and domain databases

    InterProiIPR000644. CBS_dom.
    IPR002550. DUF21.
    [Graphical view]
    PfamiPF00571. CBS. 1 hit.
    PF01595. DUF21. 1 hit.
    [Graphical view]
    PROSITEiPS51371. CBS. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NE01-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAAVAAAGR LGWLFAALCL GNAAGEAAPG PRVLGFCLEE DGAAGAGWVR    50
    GGAARDTPDA TFLLRLFGPG FANSSWSWVA PEGAGCREEA ASPAGEWRAL 100
    LRLRLRAEAV RPHSALLAVR VEPGGGAAEE AAPPWALGLG AAGLLALAAL 150
    ARGLQLSALA LAPAEVQVLR ESGSEAERAA ARRLEPARRW AGCALGALLL 200
    LASLAQAALA VLLYRAAGQR AVPAVLGSAG LVFLVGEVVP AAVSGRWTLA 250
    LAPRALGLSR LAVLLTLPVA LPVGQLLELA ARPGRLRERV LELARGGGDP 300
    YSDLSKGVLR CRTVEDVLTP LEDCFMLDAS TVLDFGVLAS IMQSGHTRIP 350
    VYEEERSNIV DMLYLKDLAF VDPEDCTPLS TITRFYNHPL HFVFNDTKLD 400
    AVLEEFKRGK SHLAIVQKVN NEGEGDPFYE VLGLVTLEDV IEEIIRSEIL 450
    DESEDYRDTV VKRKPASLMA PLKRKEEFSL FKVSDDEYKV TISPQLLLAT 500
    QRFLSREVDV FSPLRISEKV LLHLLKHPSV NQEVRFDESN RLATHHYLYQ 550
    RSQPVDYFIL ILQGRVEVEI GKEGLKFENG AFTYYGVSAL TVPSSVHQSP 600
    VSSLQPIRHD LQPDPGDGTH SSAYCPDYTV RALSDLQLIK VTRLQYLNAL 650
    LATRAQNLPQ SPENTDLQVI PGSQTRLLGE KTTTAAGSSH SRPGVPVEGS 700
    PGRNPGV 707
    Length:707
    Mass (Da):76,119
    Last modified:October 1, 2002 - v1
    Checksum:i22BE4A950A8DA7F5
    GO
    Isoform 2 (identifier: Q8NE01-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         410-457: Missing.

    Show »
    Length:659
    Mass (Da):70,632
    Checksum:iD5D6950DBB25517B
    GO
    Isoform 3 (identifier: Q8NE01-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         410-457: Missing.
         694-707: GVPVEGSPGRNPGV → SLPLLPRGRDSAAYSDSDLFGLSHLVSAVTAFVWP

    Note: No experimental confirmation available.

    Show »
    Length:680
    Mass (Da):73,057
    Checksum:i96670B9CE30C8E47
    GO

    Sequence cautioni

    The sequence BAA90891.1 differs from that shown. Reason: Frameshift at position 315.
    The sequence AAF86377.1 differs from that shown. Reason: Erroneous initiation.
    The sequence AAH07199.3 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti315 – 3151E → Q in BAA90891. (PubMed:14702039)Curated
    Sequence conflicti404 – 4041E → Q in BAA90891. (PubMed:14702039)Curated
    Sequence conflicti407 – 4071K → M in BAA90891. (PubMed:14702039)Curated
    Sequence conflicti482 – 4821K → T in BAA90891. (PubMed:14702039)Curated
    Sequence conflicti532 – 5321Q → H in BAA90891. (PubMed:14702039)Curated
    Sequence conflicti533 – 5331E → A in BAA90891. (PubMed:14702039)Curated
    Sequence conflicti543 – 5431A → V in BAA90891. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei410 – 45748Missing in isoform 2 and isoform 3. 2 PublicationsVSP_027082Add
    BLAST
    Alternative sequencei694 – 70714GVPVE…RNPGV → SLPLLPRGRDSAAYSDSDLF GLSHLVSAVTAFVWP in isoform 3. 1 PublicationVSP_027083Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000025 mRNA. Translation: BAA90891.1. Frameshift.
    AK126847 mRNA. Translation: BAG54379.1.
    AC092636 Genomic DNA. Translation: AAY14964.1.
    BC007199 mRNA. Translation: AAH07199.3. Different initiation.
    BC022944 mRNA. Translation: AAH22944.1.
    BC037272 mRNA. Translation: AAH37272.1.
    AF216965 mRNA. Translation: AAF86377.1. Different initiation.
    CCDSiCCDS2025.1. [Q8NE01-1]
    CCDS2026.1. [Q8NE01-2]
    RefSeqiNP_060093.3. NM_017623.4. [Q8NE01-1]
    NP_951060.1. NM_199078.2. [Q8NE01-2]
    XP_005263975.1. XM_005263918.2. [Q8NE01-3]
    UniGeneiHs.711617.

    Genome annotation databases

    EnsembliENST00000305510; ENSP00000305449; ENSG00000168763. [Q8NE01-1]
    ENST00000377060; ENSP00000366260; ENSG00000168763. [Q8NE01-2]
    GeneIDi26505.
    KEGGihsa:26505.
    UCSCiuc002swy.3. human. [Q8NE01-1]
    uc002swz.3. human. [Q8NE01-2]

    Polymorphism databases

    DMDMi74751242.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000025 mRNA. Translation: BAA90891.1 . Frameshift.
    AK126847 mRNA. Translation: BAG54379.1 .
    AC092636 Genomic DNA. Translation: AAY14964.1 .
    BC007199 mRNA. Translation: AAH07199.3 . Different initiation.
    BC022944 mRNA. Translation: AAH22944.1 .
    BC037272 mRNA. Translation: AAH37272.1 .
    AF216965 mRNA. Translation: AAF86377.1 . Different initiation.
    CCDSi CCDS2025.1. [Q8NE01-1 ]
    CCDS2026.1. [Q8NE01-2 ]
    RefSeqi NP_060093.3. NM_017623.4. [Q8NE01-1 ]
    NP_951060.1. NM_199078.2. [Q8NE01-2 ]
    XP_005263975.1. XM_005263918.2. [Q8NE01-3 ]
    UniGenei Hs.711617.

    3D structure databases

    ProteinModelPortali Q8NE01.
    SMRi Q8NE01. Positions 309-452.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117712. 16 interactions.
    IntActi Q8NE01. 9 interactions.
    MINTi MINT-1452431.
    STRINGi 9606.ENSP00000305449.

    Protein family/group databases

    TCDBi 9.A.40.3.3. the hlyc/corc (hcc) family.

    PTM databases

    PhosphoSitei Q8NE01.

    Polymorphism databases

    DMDMi 74751242.

    Proteomic databases

    MaxQBi Q8NE01.
    PaxDbi Q8NE01.
    PRIDEi Q8NE01.

    Protocols and materials databases

    DNASUi 26505.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000305510 ; ENSP00000305449 ; ENSG00000168763 . [Q8NE01-1 ]
    ENST00000377060 ; ENSP00000366260 ; ENSG00000168763 . [Q8NE01-2 ]
    GeneIDi 26505.
    KEGGi hsa:26505.
    UCSCi uc002swy.3. human. [Q8NE01-1 ]
    uc002swz.3. human. [Q8NE01-2 ]

    Organism-specific databases

    CTDi 26505.
    GeneCardsi GC02P097481.
    H-InvDB HIX0002282.
    HIX0117685.
    HGNCi HGNC:104. CNNM3.
    HPAi HPA016711.
    MIMi 607804. gene.
    neXtProti NX_Q8NE01.
    PharmGKBi PA26670.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1253.
    HOGENOMi HOG000231947.
    HOVERGENi HBG074775.
    InParanoidi Q8NE01.
    KOi K16302.
    OMAi EPARRWA.
    OrthoDBi EOG72ZCD7.
    PhylomeDBi Q8NE01.
    TreeFami TF101012.

    Miscellaneous databases

    ChiTaRSi CNNM3. human.
    GenomeRNAii 26505.
    NextBioi 48786.
    PROi Q8NE01.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q8NE01.
    CleanExi HS_CNNM3.
    Genevestigatori Q8NE01.

    Family and domain databases

    InterProi IPR000644. CBS_dom.
    IPR002550. DUF21.
    [Graphical view ]
    Pfami PF00571. CBS. 1 hit.
    PF01595. DUF21. 1 hit.
    [Graphical view ]
    PROSITEi PS51371. CBS. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 313-707 (ISOFORM 2).
      Tissue: Adipose tissue and Amygdala.
    2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 275-707 (ISOFORM 3).
      Tissue: Adrenal cortex, Muscle and Testis.
    4. "Molecular cloning and characterization of a novel gene family of four ancient conserved domain proteins (ACDP)."
      Wang C.-Y., Shi J.-D., Yang P., Kumar P.G., Li Q.-Z., Run Q.-G., Su Y.-C., Scott H.S., Kao K.-J., She J.-X.
      Gene 306:37-44(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 294-707 (ISOFORM 1), TISSUE SPECIFICITY.
      Tissue: Brain.
    5. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-661, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiCNNM3_HUMAN
    AccessioniPrimary (citable) accession number: Q8NE01
    Secondary accession number(s): B3KX67
    , Q8TBV4, Q96IW4, Q9NRK4, Q9NXW6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 24, 2007
    Last sequence update: October 1, 2002
    Last modified: October 1, 2014
    This is version 109 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Shares weak sequence similarity with the cyclin family, hence its name. However, it has no cyclin-like function in vivo.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3