Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable aminopeptidase NPEPL1

Gene

NPEPL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probably catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Cofactori

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi260 – 2601Zinc 2By similarity
Metal bindingi265 – 2651Zinc 1By similarity
Metal bindingi265 – 2651Zinc 2By similarity
Active sitei272 – 2721Sequence analysis
Metal bindingi283 – 2831Zinc 2By similarity
Metal bindingi342 – 3421Zinc 1By similarity
Metal bindingi344 – 3441Zinc 1By similarity
Metal bindingi344 – 3441Zinc 2By similarity
Active sitei346 – 3461Sequence analysis

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Aminopeptidase, Hydrolase, Protease

Keywords - Ligandi

Manganese, Metal-binding, Zinc

Protein family/group databases

MEROPSiM17.006.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable aminopeptidase NPEPL1 (EC:3.4.11.-)
Alternative name(s):
Aminopeptidase-like 1
Gene namesi
Name:NPEPL1
Synonyms:KIAA1974
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:16244. NPEPL1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: InterPro
  • nucleus Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31702.

Polymorphism and mutation databases

BioMutaiNPEPL1.
DMDMi68847034.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 523523Probable aminopeptidase NPEPL1PRO_0000165828Add
BLAST

Proteomic databases

EPDiQ8NDH3.
MaxQBiQ8NDH3.
PaxDbiQ8NDH3.
PeptideAtlasiQ8NDH3.
PRIDEiQ8NDH3.

PTM databases

iPTMnetiQ8NDH3.
PhosphoSiteiQ8NDH3.

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000215440.
CleanExiHS_NPEPL1.
ExpressionAtlasiQ8NDH3. baseline and differential.
GenevisibleiQ8NDH3. HS.

Organism-specific databases

HPAiCAB004986.
CAB017025.
HPA036356.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TFCP2Q128003EBI-10269715,EBI-717422

Protein-protein interaction databases

BioGridi122832. 20 interactions.
IntActiQ8NDH3. 1 interaction.
STRINGi9606.ENSP00000348395.

Structurei

3D structure databases

ProteinModelPortaliQ8NDH3.
SMRiQ8NDH3. Positions 68-496.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M17 family.Curated

Phylogenomic databases

eggNOGiKOG2597. Eukaryota.
COG0260. LUCA.
GeneTreeiENSGT00530000063255.
HOVERGENiHBG053563.
InParanoidiQ8NDH3.
KOiK09611.
OMAiPGVWVHV.
OrthoDBiEOG091G0A99.
PhylomeDBiQ8NDH3.
TreeFamiTF314954.

Family and domain databases

CDDicd00433. Peptidase_M17. 1 hit.
InterProiIPR011356. Leucine_aapep/pepB.
IPR000819. Peptidase_M17_C.
[Graphical view]
PANTHERiPTHR11963. PTHR11963. 1 hit.
PfamiPF00883. Peptidase_M17. 1 hit.
[Graphical view]
PRINTSiPR00481. LAMNOPPTDASE.
PROSITEiPS00631. CYTOSOL_AP. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NDH3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MANVGLQFQA SAGDSDPQSR PLLLLGQLHH LHRVPWSHVR GKLQPRVTEE
60 70 80 90 100
LWQAALSTLN PNPTDSCPLY LNYATVAALP CRVSRHNSPS AAHFITRLVR
110 120 130 140 150
TCLPPGAHRC IVMVCEQPEV FASACALARA FPLFTHRSGA SRRLEKKTVT
160 170 180 190 200
VEFFLVGQDN GPVEVSTLQC LANATDGVRL AARIVDTPCN EMNTDTFLEE
210 220 230 240 250
INKVGKELGI IPTIIRDEEL KTRGFGGIYG VGKAALHPPA LAVLSHTPDG
260 270 280 290 300
ATQTIAWVGK GIVYDTGGLS IKGKTTMPGM KRDCGGAAAV LGAFRAAIKQ
310 320 330 340 350
GFKDNLHAVF CLAENSVGPN ATRPDDIHLL YSGKTVEINN TDAEGRLVLA
360 370 380 390 400
DGVSYACKDL GADIILDMAT LTGAQGIATG KYHAAVLTNS AEWEAACVKA
410 420 430 440 450
GRKCGDLVHP LVYCPELHFS EFTSAVADMK NSVADRDNSP SSCAGLFIAS
460 470 480 490 500
HIGFDWPGVW VHLDIAAPVH AGERATGFGV ALLLALFGRA SEDPLLNLVS
510 520
PLGCEVDVEE GDLGRDSKRR RLV
Length:523
Mass (Da):55,861
Last modified:July 5, 2005 - v3
Checksum:i1B00C3422D169C0C
GO
Isoform 2 (identifier: Q8NDH3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     376-412: GIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLV → VSAPWIHPLAVVPGNPTPLLTSRWGRQRVGAAVRKFS
     413-523: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:412
Mass (Da):44,126
Checksum:i1A5C4C0CD3B96CD0
GO
Isoform 3 (identifier: Q8NDH3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     335-393: TVEINNTDAE...AAVLTNSAEW → YVWPSHSFLP...GSFGSRRTSR
     394-523: Missing.

Note: No experimental confirmation available.
Show »
Length:393
Mass (Da):42,135
Checksum:i728A4DE79C551DAB
GO
Isoform 4 (identifier: Q8NDH3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTEE → MELHGGNRGGYQPKALEQSGCW

Note: No experimental confirmation available.
Show »
Length:495
Mass (Da):52,671
Checksum:iC33D390C2734FB8C
GO
Isoform 5 (identifier: Q8NDH3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTE → M

Note: No experimental confirmation available.
Show »
Length:475
Mass (Da):50,531
Checksum:iDEF6B2175609DF8B
GO

Sequence cautioni

The sequence AK307771 differs from that shown. Reason: Frameshift at position 35. Curated
The sequence BAB13861 differs from that shown. Reason: Frameshift at position 71. Curated
Isoform 2 : The sequence CAD38816 differs from that shown. Reason: Frameshift at position 335. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti87 – 871N → S in BAD96814 (Ref. 2) Curated
Sequence conflicti151 – 1511V → L in AK307771 (PubMed:14702039).Curated
Sequence conflicti204 – 2041V → A in BAB13861 (PubMed:14702039).Curated
Sequence conflicti323 – 3231R → G in BAB13861 (PubMed:14702039).Curated
Sequence conflicti502 – 5021L → P in BAG60029 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti303 – 3031K → R.
Corresponds to variant rs8116292 [ dbSNP | Ensembl ].
VAR_059756
Natural varianti513 – 5131L → V.3 Publications
Corresponds to variant rs6026468 [ dbSNP | Ensembl ].
VAR_059757

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5050MANVG…RVTEE → MELHGGNRGGYQPKALEQSG CW in isoform 4. 1 PublicationVSP_044526Add
BLAST
Alternative sequencei1 – 4949MANVG…PRVTE → M in isoform 5. 1 PublicationVSP_044527Add
BLAST
Alternative sequencei335 – 39359TVEIN…NSAEW → YVWPSHSFLPTVGTRDPSRP AMPAHSRHIGRALSVGVPWA AGSLLPGGLGSFGSRRTSR in isoform 3. 1 PublicationVSP_007251Add
BLAST
Alternative sequencei376 – 41237GIATG…VHPLV → VSAPWIHPLAVVPGNPTPLL TSRWGRQRVGAAVRKFS in isoform 2. 1 PublicationVSP_007253Add
BLAST
Alternative sequencei394 – 523130Missing in isoform 3. 1 PublicationVSP_007252Add
BLAST
Alternative sequencei413 – 523111Missing in isoform 2. 1 PublicationVSP_007254Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021645 mRNA. Translation: BAB13861.1. Frameshift.
AK297667 mRNA. Translation: BAG60029.1.
AK307771 mRNA. No translation available.
AK223094 mRNA. Translation: BAD96814.1.
AL139349 Genomic DNA. Translation: CAX14988.1.
CH471077 Genomic DNA. Translation: EAW75479.1.
BC020507 mRNA. Translation: AAH20507.2.
AB075854 mRNA. Translation: BAB85560.1.
AL833971 mRNA. Translation: CAD38816.2. Frameshift.
CCDSiCCDS46621.1. [Q8NDH3-1]
CCDS56200.1. [Q8NDH3-4]
CCDS56201.1. [Q8NDH3-5]
RefSeqiNP_001191801.1. NM_001204872.1. [Q8NDH3-4]
NP_001191802.1. NM_001204873.1. [Q8NDH3-5]
NP_078939.3. NM_024663.3. [Q8NDH3-1]
UniGeneiHs.654868.

Genome annotation databases

EnsembliENST00000356091; ENSP00000348395; ENSG00000215440. [Q8NDH3-1]
ENST00000525817; ENSP00000437112; ENSG00000215440. [Q8NDH3-5]
ENST00000525967; ENSP00000434810; ENSG00000215440. [Q8NDH3-4]
GeneIDi79716.
KEGGihsa:79716.
UCSCiuc010gjo.3. human. [Q8NDH3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021645 mRNA. Translation: BAB13861.1. Frameshift.
AK297667 mRNA. Translation: BAG60029.1.
AK307771 mRNA. No translation available.
AK223094 mRNA. Translation: BAD96814.1.
AL139349 Genomic DNA. Translation: CAX14988.1.
CH471077 Genomic DNA. Translation: EAW75479.1.
BC020507 mRNA. Translation: AAH20507.2.
AB075854 mRNA. Translation: BAB85560.1.
AL833971 mRNA. Translation: CAD38816.2. Frameshift.
CCDSiCCDS46621.1. [Q8NDH3-1]
CCDS56200.1. [Q8NDH3-4]
CCDS56201.1. [Q8NDH3-5]
RefSeqiNP_001191801.1. NM_001204872.1. [Q8NDH3-4]
NP_001191802.1. NM_001204873.1. [Q8NDH3-5]
NP_078939.3. NM_024663.3. [Q8NDH3-1]
UniGeneiHs.654868.

3D structure databases

ProteinModelPortaliQ8NDH3.
SMRiQ8NDH3. Positions 68-496.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122832. 20 interactions.
IntActiQ8NDH3. 1 interaction.
STRINGi9606.ENSP00000348395.

Protein family/group databases

MEROPSiM17.006.

PTM databases

iPTMnetiQ8NDH3.
PhosphoSiteiQ8NDH3.

Polymorphism and mutation databases

BioMutaiNPEPL1.
DMDMi68847034.

Proteomic databases

EPDiQ8NDH3.
MaxQBiQ8NDH3.
PaxDbiQ8NDH3.
PeptideAtlasiQ8NDH3.
PRIDEiQ8NDH3.

Protocols and materials databases

DNASUi79716.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356091; ENSP00000348395; ENSG00000215440. [Q8NDH3-1]
ENST00000525817; ENSP00000437112; ENSG00000215440. [Q8NDH3-5]
ENST00000525967; ENSP00000434810; ENSG00000215440. [Q8NDH3-4]
GeneIDi79716.
KEGGihsa:79716.
UCSCiuc010gjo.3. human. [Q8NDH3-1]

Organism-specific databases

CTDi79716.
GeneCardsiNPEPL1.
HGNCiHGNC:16244. NPEPL1.
HPAiCAB004986.
CAB017025.
HPA036356.
neXtProtiNX_Q8NDH3.
PharmGKBiPA31702.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2597. Eukaryota.
COG0260. LUCA.
GeneTreeiENSGT00530000063255.
HOVERGENiHBG053563.
InParanoidiQ8NDH3.
KOiK09611.
OMAiPGVWVHV.
OrthoDBiEOG091G0A99.
PhylomeDBiQ8NDH3.
TreeFamiTF314954.

Miscellaneous databases

ChiTaRSiNPEPL1. human.
GenomeRNAii79716.
PROiQ8NDH3.

Gene expression databases

BgeeiENSG00000215440.
CleanExiHS_NPEPL1.
ExpressionAtlasiQ8NDH3. baseline and differential.
GenevisibleiQ8NDH3. HS.

Family and domain databases

CDDicd00433. Peptidase_M17. 1 hit.
InterProiIPR011356. Leucine_aapep/pepB.
IPR000819. Peptidase_M17_C.
[Graphical view]
PANTHERiPTHR11963. PTHR11963. 1 hit.
PfamiPF00883. Peptidase_M17. 1 hit.
[Graphical view]
PRINTSiPR00481. LAMNOPPTDASE.
PROSITEiPS00631. CYTOSOL_AP. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPEPL1_HUMAN
AccessioniPrimary (citable) accession number: Q8NDH3
Secondary accession number(s): A6NGZ0
, B4DMW7, B7ZBN0, E9PN47, G5EA34, Q53G37, Q5W083, Q8TF28, Q8WUI2, Q9H1T6, Q9HAI5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: July 5, 2005
Last modified: September 7, 2016
This is version 130 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Peptidase families
    Classification of peptidase families and list of entries
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.