Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable aminopeptidase NPEPL1

Gene

NPEPL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probably catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Cofactori

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi260Zinc 2By similarity1
Metal bindingi265Zinc 1By similarity1
Metal bindingi265Zinc 2By similarity1
Active sitei272Sequence analysis1
Metal bindingi283Zinc 2By similarity1
Metal bindingi342Zinc 1By similarity1
Metal bindingi344Zinc 1By similarity1
Metal bindingi344Zinc 2By similarity1
Active sitei346Sequence analysis1

GO - Molecular functioni

Keywordsi

Molecular functionAminopeptidase, Hydrolase, Protease
LigandManganese, Metal-binding, Zinc

Protein family/group databases

MEROPSiM17.006

Names & Taxonomyi

Protein namesi
Recommended name:
Probable aminopeptidase NPEPL1 (EC:3.4.11.-)
Alternative name(s):
Aminopeptidase-like 1
Gene namesi
Name:NPEPL1
Synonyms:KIAA1974
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000215440.11
HGNCiHGNC:16244 NPEPL1
neXtProtiNX_Q8NDH3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi79716
OpenTargetsiENSG00000215440
PharmGKBiPA31702

Chemistry databases

ChEMBLiCHEMBL3831223

Polymorphism and mutation databases

BioMutaiNPEPL1
DMDMi68847034

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001658281 – 523Probable aminopeptidase NPEPL1Add BLAST523

Proteomic databases

EPDiQ8NDH3
MaxQBiQ8NDH3
PaxDbiQ8NDH3
PeptideAtlasiQ8NDH3
PRIDEiQ8NDH3

PTM databases

iPTMnetiQ8NDH3
PhosphoSitePlusiQ8NDH3

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000215440
CleanExiHS_NPEPL1
ExpressionAtlasiQ8NDH3 baseline and differential
GenevisibleiQ8NDH3 HS

Organism-specific databases

HPAiCAB004986
CAB017025
HPA036356

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TFCP2Q128003EBI-10269715,EBI-717422

Protein-protein interaction databases

BioGridi122832, 21 interactors
IntActiQ8NDH3, 2 interactors
STRINGi9606.ENSP00000348395

Structurei

3D structure databases

ProteinModelPortaliQ8NDH3
SMRiQ8NDH3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase M17 family.Curated

Phylogenomic databases

eggNOGiKOG2597 Eukaryota
COG0260 LUCA
GeneTreeiENSGT00530000063255
HOVERGENiHBG053563
InParanoidiQ8NDH3
KOiK09611
OMAiRNCGDLV
OrthoDBiEOG091G0A99
PhylomeDBiQ8NDH3
TreeFamiTF314954

Family and domain databases

CDDicd00433 Peptidase_M17, 1 hit
InterProiView protein in InterPro
IPR011356 Leucine_aapep/pepB
IPR000819 Peptidase_M17_C
PANTHERiPTHR11963 PTHR11963, 1 hit
PfamiView protein in Pfam
PF00883 Peptidase_M17, 1 hit
PRINTSiPR00481 LAMNOPPTDASE
PROSITEiView protein in PROSITE
PS00631 CYTOSOL_AP, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NDH3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MANVGLQFQA SAGDSDPQSR PLLLLGQLHH LHRVPWSHVR GKLQPRVTEE
60 70 80 90 100
LWQAALSTLN PNPTDSCPLY LNYATVAALP CRVSRHNSPS AAHFITRLVR
110 120 130 140 150
TCLPPGAHRC IVMVCEQPEV FASACALARA FPLFTHRSGA SRRLEKKTVT
160 170 180 190 200
VEFFLVGQDN GPVEVSTLQC LANATDGVRL AARIVDTPCN EMNTDTFLEE
210 220 230 240 250
INKVGKELGI IPTIIRDEEL KTRGFGGIYG VGKAALHPPA LAVLSHTPDG
260 270 280 290 300
ATQTIAWVGK GIVYDTGGLS IKGKTTMPGM KRDCGGAAAV LGAFRAAIKQ
310 320 330 340 350
GFKDNLHAVF CLAENSVGPN ATRPDDIHLL YSGKTVEINN TDAEGRLVLA
360 370 380 390 400
DGVSYACKDL GADIILDMAT LTGAQGIATG KYHAAVLTNS AEWEAACVKA
410 420 430 440 450
GRKCGDLVHP LVYCPELHFS EFTSAVADMK NSVADRDNSP SSCAGLFIAS
460 470 480 490 500
HIGFDWPGVW VHLDIAAPVH AGERATGFGV ALLLALFGRA SEDPLLNLVS
510 520
PLGCEVDVEE GDLGRDSKRR RLV
Length:523
Mass (Da):55,861
Last modified:July 5, 2005 - v3
Checksum:i1B00C3422D169C0C
GO
Isoform 2 (identifier: Q8NDH3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     376-412: GIATGKYHAAVLTNSAEWEAACVKAGRKCGDLVHPLV → VSAPWIHPLAVVPGNPTPLLTSRWGRQRVGAAVRKFS
     413-523: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:412
Mass (Da):44,126
Checksum:i1A5C4C0CD3B96CD0
GO
Isoform 3 (identifier: Q8NDH3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     335-393: TVEINNTDAE...AAVLTNSAEW → YVWPSHSFLP...GSFGSRRTSR
     394-523: Missing.

Note: No experimental confirmation available.
Show »
Length:393
Mass (Da):42,135
Checksum:i728A4DE79C551DAB
GO
Isoform 4 (identifier: Q8NDH3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTEE → MELHGGNRGGYQPKALEQSGCW

Note: No experimental confirmation available.
Show »
Length:495
Mass (Da):52,671
Checksum:iC33D390C2734FB8C
GO
Isoform 5 (identifier: Q8NDH3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MANVGLQFQASAGDSDPQSRPLLLLGQLHHLHRVPWSHVRGKLQPRVTE → M

Note: No experimental confirmation available.
Show »
Length:475
Mass (Da):50,531
Checksum:iDEF6B2175609DF8B
GO

Sequence cautioni

The sequence AK307771 differs from that shown. Reason: Frameshift at position 35.Curated
The sequence BAB13861 differs from that shown. Reason: Frameshift at position 71.Curated
Isoform 2 : The sequence CAD38816 differs from that shown. Reason: Frameshift at position 335.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti87N → S in BAD96814 (Ref. 2) Curated1
Sequence conflicti151V → L in AK307771 (PubMed:14702039).Curated1
Sequence conflicti204V → A in BAB13861 (PubMed:14702039).Curated1
Sequence conflicti323R → G in BAB13861 (PubMed:14702039).Curated1
Sequence conflicti502L → P in BAG60029 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_059756303K → R. Corresponds to variant dbSNP:rs8116292Ensembl.1
Natural variantiVAR_059757513L → V3 PublicationsCorresponds to variant dbSNP:rs6026468Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0445261 – 50MANVG…RVTEE → MELHGGNRGGYQPKALEQSG CW in isoform 4. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_0445271 – 49MANVG…PRVTE → M in isoform 5. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_007251335 – 393TVEIN…NSAEW → YVWPSHSFLPTVGTRDPSRP AMPAHSRHIGRALSVGVPWA AGSLLPGGLGSFGSRRTSR in isoform 3. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_007253376 – 412GIATG…VHPLV → VSAPWIHPLAVVPGNPTPLL TSRWGRQRVGAAVRKFS in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_007252394 – 523Missing in isoform 3. 1 PublicationAdd BLAST130
Alternative sequenceiVSP_007254413 – 523Missing in isoform 2. 1 PublicationAdd BLAST111

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK021645 mRNA Translation: BAB13861.1 Frameshift.
AK297667 mRNA Translation: BAG60029.1
AK307771 mRNA No translation available.
AK223094 mRNA Translation: BAD96814.1
AL139349 Genomic DNA No translation available.
CH471077 Genomic DNA Translation: EAW75479.1
BC020507 mRNA Translation: AAH20507.2
AB075854 mRNA Translation: BAB85560.1
AL833971 mRNA Translation: CAD38816.2 Frameshift.
CCDSiCCDS46621.1 [Q8NDH3-1]
CCDS56200.1 [Q8NDH3-4]
CCDS56201.1 [Q8NDH3-5]
RefSeqiNP_001191801.1, NM_001204872.1 [Q8NDH3-4]
NP_001191802.1, NM_001204873.1 [Q8NDH3-5]
NP_078939.3, NM_024663.3 [Q8NDH3-1]
UniGeneiHs.654868

Genome annotation databases

EnsembliENST00000356091; ENSP00000348395; ENSG00000215440 [Q8NDH3-1]
ENST00000525817; ENSP00000437112; ENSG00000215440 [Q8NDH3-5]
ENST00000525967; ENSP00000434810; ENSG00000215440 [Q8NDH3-4]
GeneIDi79716
KEGGihsa:79716
UCSCiuc010gjo.3 human [Q8NDH3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiPEPL1_HUMAN
AccessioniPrimary (citable) accession number: Q8NDH3
Secondary accession number(s): A6NGZ0
, B4DMW7, B7ZBN0, E9PN47, G5EA34, Q53G37, Q5W083, Q8TF28, Q8WUI2, Q9H1T6, Q9HAI5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: July 5, 2005
Last modified: March 28, 2018
This is version 141 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health