Reviewed,
UniProtKB/Swiss-Prot Q8ND25 (ZNRF1_HUMAN)
Last modified
November 24, 2009.
Version 50.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase ZNRF1 EC=6.3.2.- Alternative name(s): Zinc/RING finger protein 1 Nerve injury-induced gene 283 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 227 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to substrates. May play a role in the establisment and maintenance of neuronal transmission and plasticity via its ubiquitin-protein ligase activity. Ref.4 |
| Pathway | |
| Subcellular location | Endosome. Lysosome. Membrane; Peripheral membrane protein. Cytoplasmic vesicle › secretory vesicle › synaptic vesicle membrane; Peripheral membrane protein Potential. Note: Associated with synaptic vesicle membranes in neurons. |
| Tissue specificity | Expressed primarily in the nervous system, with expression higher in developing brain relative to adult. Expressed at low levels in testis and thymus. Ref.4 Ref.1 |
| Domain | The RING-type zinc finger domain is required for E3 ligase activity By similarity. |
| Sequence similarities | Contains 1 RING-type zinc finger. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDC34 | P49427 | 1 | EBI-2129250,EBI-975634 | |
| UBE2D1 | P51668 | 1 | EBI-2129250,EBI-743540 | |
| UBE2D2 | P62837 | 1 | EBI-2129250,EBI-347677 | |
| UBE2E1 | P51965 | 1 | EBI-2129250,EBI-348546 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8ND25-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8ND25-2) The sequence of this isoform differs from the canonical sequence as follows: 173-173: N → NGRIQRSLRGAQPEKTWLSGRTLQEQPWRTECSWAPMAQMQSYPHCPVENRE | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Probable | ||||||
| Chain | 2 – 227 | 226 | E3 ubiquitin-protein ligase ZNRF1 | PRO_0000277799 | |||||
Regions | |||||||||
| Zinc finger | 184 – 225 | 42 | RING-type; atypical | ||||||
| Region | 2 – 10 | 9 | Required for endosomal and lysosomal localization and myristoylation | ||||||
Amino acid modifications | |||||||||
| Modified residue | 52 | 1 | Phosphoserine | ||||||
| Modified residue | 53 | 1 | Phosphoserine | ||||||
| Modified residue | 123 | 1 | Phosphoserine By similarity | ||||||
| Lipidation | 2 | 1 | N-myristoyl glycine Probable | ||||||
Natural variations | |||||||||
| Alternative sequence | 173 | 1 | N → NGRIQRSLRGAQPEKTWLSG RTLQEQPWRTECSWAPMAQM QSYPHCPVENRE in isoform 2. | VSP_023088 | |||||
Experimental info | |||||||||
| Mutagenesis | 184 | 1 | C → A: Loss of E3 activity. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of genes induced in peripheral nerve after injury. Expression profiling and novel gene discovery." Araki T., Nagarajan R., Milbrandt J. J. Biol. Chem. 276:34131-34141(2001) [PubMed: 11427537] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed: 11230166] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 8-278 (ISOFORM 2). Tissue: Testis. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| [4] | "ZNRF proteins constitute a family of presynaptic E3 ubiquitin ligases." Araki T., Milbrandt J. J. Neurosci. 23:9385-9394(2003) [PubMed: 14561866] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, MYRISTOYLATION, MUTAGENESIS OF CYS-184. |
| [5] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-52 AND SER-53, MASS SPECTROMETRY. Tissue: T-cell. |
Cross-references
Sequence databases | |
|---|---|
| AF378524 mRNA. Translation: AAK69753.1. AL136903 mRNA. Translation: CAB66837.1. AL834440 mRNA. Translation: CAD39100.1. BC007235 mRNA. Translation: AAH07235.1. | |
| IPI | IPI00031059. IPI00168439. |
| RefSeq | NP_115644.1. |
| UniGene | Hs.427284 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8ND25. 12 interactions. |
| STRING | Q8ND25. |
PTM databases | |
| PhosphoSite | Q8ND25. |
Proteomic databases | |
| PRIDE | Q8ND25. |
Genome annotation databases | |
| Ensembl | ENST00000335325; ENSP00000335091; ENSG00000186187; Homo sapiens. [Genome view] |
| GeneID | 84937. |
| KEGG | hsa:84937. |
| UCSC | uc002fdk.1. human. uc010cgr.1. human. |
Organism-specific databases | |
| CTD | 84937. |
| GeneCards | GC16P073590. |
| HGNC | HGNC:18452. ZNRF1. |
| MIM | 612060. gene. |
| PharmGKB | PA134938288. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q8ND25. |
| OMA | NGYQETG |
| OrthoDB | EOG944P61 |
Gene expression databases | |
| ArrayExpress | Q8ND25. |
| Bgee | Q8ND25. |
| CleanEx | HS_ZNRF1. |
| Genevestigator | Q8ND25. |
Family and domain databases | |
| InterPro | IPR018957. Znf_C3HC4_RING-type. IPR001841. Znf_RING. [Graphical view] |
| Pfam | PF00097. zf-C3HC4. 1 hit. [Graphical view] |
| SMART | SM00184. RING. 1 hit. [Graphical view] |
| PROSITE | PS00518. ZF_RING_1. False negative. PS50089. ZF_RING_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 75388. |
| SOURCE | Search... |
Entry information
| Entry name | ZNRF1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8ND25 Secondary accession number(s): Q9H083 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


