Q8ND25 (ZNRF1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase ZNRF1 EC=6.3.2.- Alternative name(s): Nerve injury-induced gene 283 protein Zinc/RING finger protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 227 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | E3 ubiquitin-protein ligase that mediates the ubiquitination of AKT1 and GLUL, thereby playing a role in neuron cells differentiation. Plays a role in the establishment and maintenance of neuronal transmission and plasticity. Regulates Schwann cells differentiation by mediating ubiquitination of GLUL. Promotes neurodegeneration by mediating 'Lys-48'-linked polyubiquitination and subsequent degradation of AKT1 in axons: degradation of AKT1 prevents AKT1-mediated phosphorylation of GSK3B, leading to GSK3B activation and phosphorylation of DPYSL2/CRMP2 followed by destabilization of microtubule assembly in axons Probable. Ref.6 |
| Pathway | |
| Subunit structure | Interacts with AKT1, GLUL and TUBB2A By similarity. |
| Subcellular location | Endosome. Lysosome. Membrane; Peripheral membrane protein. Cytoplasmic vesicle › secretory vesicle › synaptic vesicle membrane; Peripheral membrane protein Potential. Note: Associated with synaptic vesicle membranes in neurons. |
| Tissue specificity | Expressed primarily in the nervous system, with expression higher in developing brain relative to adult. Expressed at low levels in testis and thymus. Ref.1 Ref.6 |
| Domain | The RING-type zinc finger domain is required for E3 ligase activity By similarity. |
| Sequence similarities | Contains 1 RING-type zinc finger. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| UBE2D1 | P51668 | 4 | EBI-2129250,EBI-743540 | |
| UBE2D2 | P62837 | 4 | EBI-2129250,EBI-347677 | |
| UBE2D3 | P61077 | 3 | EBI-2129250,EBI-348268 | |
| UBE2D4 | Q9Y2X8 | 3 | EBI-2129250,EBI-745527 | |
| UBE2E1 | P51965 | 3 | EBI-2129250,EBI-348546 | |
| UBE2N | P61088 | 3 | EBI-2129250,EBI-1052908 | |
| UBE2V1 | Q13404 | 2 | EBI-2129250,EBI-1050671 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8ND25-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8ND25-2) The sequence of this isoform differs from the canonical sequence as follows: 173-173: N → NGRIQRSLRGAQPEKTWLSGRTLQEQPWRTECSWAPMAQMQSYPHCPVENRE | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 227 | 227 | E3 ubiquitin-protein ligase ZNRF1 | PRO_0000277799 | |||||
Regions | |||||||||
| Zinc finger | 184 – 225 | 42 | RING-type; atypical | ||||||
| Region | 1 – 10 | 10 | Required for endosomal and lysosomal localization and myristoylation | ||||||
Amino acid modifications | |||||||||
| Modified residue | 52 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 53 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 123 | 1 | Phosphoserine By similarity | ||||||
| Lipidation | 2 | 1 | N-myristoyl glycine Probable | ||||||
Natural variations | |||||||||
| Alternative sequence | 173 | 1 | N → NGRIQRSLRGAQPEKTWLSG RTLQEQPWRTECSWAPMAQM QSYPHCPVENRE in isoform 2. | VSP_023088 | |||||
Experimental info | |||||||||
| Mutagenesis | 184 | 1 | C → A: Loss of E3 activity. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of genes induced in peripheral nerve after injury. Expression profiling and novel gene discovery." Araki T., Nagarajan R., Milbrandt J. J. Biol. Chem. 276:34131-34141(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 8-278 (ISOFORM 2). Tissue: Testis. |
| [3] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung. |
| [6] | "ZNRF proteins constitute a family of presynaptic E3 ubiquitin ligases." Araki T., Milbrandt J. J. Neurosci. 23:9385-9394(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY, MYRISTOYLATION, MUTAGENESIS OF CYS-184. |
| [7] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-52 AND SER-53, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF378524 mRNA. Translation: AAK69753.1. AL136903 mRNA. Translation: CAB66837.1. AL834440 mRNA. Translation: CAD39100.1. AC092383 Genomic DNA. No translation available. AC099508 Genomic DNA. No translation available. CH471114 Genomic DNA. Translation: EAW95668.1. CH471114 Genomic DNA. Translation: EAW95670.1. CH471114 Genomic DNA. Translation: EAW95671.1. BC007235 mRNA. Translation: AAH07235.1. |
| IPI | IPI00031059. IPI00168439. |
| RefSeq | NP_115644.1. NM_032268.4. |
| UniGene | Hs.427284. |
3D structure databases | |
| ProteinModelPortal | Q8ND25. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8ND25. 12 interactions. |
| STRING | 9606.ENSP00000335091. |
PTM databases | |
| PhosphoSite | Q8ND25. |
Polymorphism databases | |
| DMDM | 126253846. |
Proteomic databases | |
| PaxDb | Q8ND25. |
| PRIDE | Q8ND25. |
Protocols and materials databases | |
| DNASU | 84937. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000320619; ENSP00000323362; ENSG00000186187. ENST00000335325; ENSP00000335091; ENSG00000186187. ENST00000567962; ENSP00000455601; ENSG00000186187. |
| GeneID | 84937. |
| KEGG | hsa:84937. |
| UCSC | uc002fdk.3. human. uc010cgr.1. human. |
Organism-specific databases | |
| CTD | 84937. |
| GeneCards | GC16P075033. |
| HGNC | HGNC:18452. ZNRF1. |
| HPA | HPA027470. |
| MIM | 612060. gene. |
| neXtProt | NX_Q8ND25. |
| PharmGKB | PA134938288. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG314053. |
| HOGENOM | HOG000285998. |
| HOVERGEN | HBG094200. |
| KO | K10694. |
| OMA | FGHYRAG. |
| OrthoDB | EOG41C6XM. |
Enzyme and pathway databases | |
| UniPathway | UPA00143. |
Gene expression databases | |
| ArrayExpress | Q8ND25. |
| Bgee | Q8ND25. |
| CleanEx | HS_ZNRF1. |
| Genevestigator | Q8ND25. |
Family and domain databases | |
| Gene3D | 3.30.40.10. 1 hit. |
| InterPro | IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] |
| Pfam | PF13639. zf-RING_2. 1 hit. [Graphical view] |
| SMART | SM00184. RING. 1 hit. [Graphical view] |
| PROSITE | PS00518. ZF_RING_1. False negative. PS50089. ZF_RING_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 84937. |
| NextBio | 75388. |
| SOURCE | Search... |
Entry information
| Entry name | ZNRF1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8ND25 Secondary accession number(s): D3DUJ9, Q9H083 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
