Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kremen protein 2

Gene

KREMEN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Receptor for Dickkopf protein. Cooperates with Dickkopf to block Wnt/beta-catenin signaling. Forms a ternary complex with Dkk1 and LRP6 and induces rapid endocytosis and removal of the Wnt receptor LRP6 from the plasma membrane (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Wnt signaling pathway

Enzyme and pathway databases

ReactomeiR-HSA-201681. TCF dependent signaling in response to WNT.
R-HSA-3772470. Negative regulation of TCF-dependent signaling by WNT ligand antagonists.
R-HSA-5339717. Misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling.
SignaLinkiQ8NCW0.
SIGNORiQ8NCW0.

Names & Taxonomyi

Protein namesi
Recommended name:
Kremen protein 2
Alternative name(s):
Dickkopf receptor 2
Kringle domain-containing transmembrane protein 2
Kringle-containing protein marking the eye and the nose
Gene namesi
Name:KREMEN2
Synonyms:KRM2
OrganismiHomo sapiens (Human)Imported
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:18797. KREMEN2.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini26 – 364339ExtracellularSequence analysisAdd
BLAST
Transmembranei365 – 38723HelicalSequence analysisAdd
BLAST
Topological domaini388 – 46275CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38683.

Polymorphism and mutation databases

BioMutaiKREMEN2.
DMDMi30173086.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence analysisAdd
BLAST
Chaini26 – 462437Kremen protein 2PRO_0000021568Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi36 ↔ 119By similarity
Glycosylationi49 – 491N-linked (GlcNAc...)Sequence analysis
Disulfide bondi60 ↔ 100By similarity
Disulfide bondi89 ↔ 114By similarity
Disulfide bondi219 ↔ 245By similarity
Glycosylationi222 – 2221N-linked (GlcNAc...)Sequence analysis
Glycosylationi244 – 2441N-linked (GlcNAc...)Sequence analysis
Glycosylationi351 – 3511N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ8NCW0.
PeptideAtlasiQ8NCW0.
PRIDEiQ8NCW0.

PTM databases

iPTMnetiQ8NCW0.

Expressioni

Gene expression databases

BgeeiQ8NCW0.
CleanExiHS_KREMEN2.
ExpressionAtlasiQ8NCW0. baseline and differential.
GenevisibleiQ8NCW0. HS.

Organism-specific databases

HPAiHPA003223.

Interactioni

Subunit structurei

Interacts with ERLEC1.By similarity

Protein-protein interaction databases

STRINGi9606.ENSP00000304422.

Structurei

3D structure databases

ProteinModelPortaliQ8NCW0.
SMRiQ8NCW0. Positions 33-173, 219-323.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini35 – 11985KringlePROSITE-ProRule annotationAdd
BLAST
Domaini121 – 21595WSCPROSITE-ProRule annotationCuratedAdd
BLAST
Domaini219 – 326108CUBPROSITE-ProRule annotationCuratedAdd
BLAST

Domaini

Binding to ERLEC1 is mediated by the oligosaccharides linked to the kringle domain.By similarity

Sequence similaritiesi

Contains 1 CUB domain.PROSITE-ProRule annotationCurated
Contains 1 kringle domain.PROSITE-ProRule annotationCurated
Contains 1 WSC domain.PROSITE-ProRule annotationCurated

Keywords - Domaini

Kringle, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4157. Eukaryota.
ENOG4111FP9. LUCA.
GeneTreeiENSGT00730000110973.
HOGENOMiHOG000070150.
HOVERGENiHBG052291.
InParanoidiQ8NCW0.
OMAiVWYRRPR.
OrthoDBiEOG7T1RB2.
PhylomeDBiQ8NCW0.
TreeFamiTF331319.

Family and domain databases

Gene3Di2.60.120.290. 1 hit.
InterProiIPR000859. CUB_dom.
IPR017076. Kremen.
IPR000001. Kringle.
IPR013806. Kringle-like.
IPR018056. Kringle_CS.
IPR002889. WSC_carb-bd.
[Graphical view]
PfamiPF00431. CUB. 1 hit.
PF00051. Kringle. 1 hit.
PF01822. WSC. 1 hit.
[Graphical view]
PIRSFiPIRSF036961. Kremen. 1 hit.
SMARTiSM00042. CUB. 1 hit.
SM00130. KR. 1 hit.
SM00321. WSC. 1 hit.
[Graphical view]
SUPFAMiSSF49854. SSF49854. 1 hit.
SSF57440. SSF57440. 1 hit.
PROSITEiPS01180. CUB. 1 hit.
PS00021. KRINGLE_1. 1 hit.
PS50070. KRINGLE_2. 1 hit.
PS51212. WSC. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1Curated (identifier: Q8NCW0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGTQALQGFL FLLFLPLLQP RGASAGSLHS PGLSECFQVN GADYRGHQNR
60 70 80 90 100
TGPRGAGRPC LFWDQTQQHS YSSASDPHGR WGLGAHNFCR NPDGDVQPWC
110 120 130 140 150
YVAETEEGIY WRYCDIPSCH MPGYLGCFVD SGAPPALSGP SGTSTKLTVQ
160 170 180 190 200
VCLRFCRMKG YQLAGVEAGY ACFCGSESDL ARGRLAPATD CDQICFGHPG
210 220 230 240 250
QLCGGDGRLG VYEVSVGSCQ GNWTAPQGVI YSPDFPDEYG PDRNCSWALG
260 270 280 290 300
PPGAALELTF RLFELADPRD RLELRDAASG SLLRAFDGAR PPPSGPLRLG
310 320 330 340 350
TAALLLTFRS DARGHAQGFA LTYRGLQDAA EDPEAPEGSA QTPAAPLDGA
360 370 380 390 400
NVSCSPRPGA PPAAIGARVF STVTAVSVLL LLLLGLLRPL RRRSCLLAPG
410 420 430 440 450
KGPPALGASR GPRRSWAVWY QQPRGVALPC SPGDPQAEGS AAGYRPLSAS
460
SQSSLRSLIS AL
Length:462
Mass (Da):48,849
Last modified:October 1, 2002 - v1
Checksum:iCE33015917A9AA68
GO
Isoform 2Curated (identifier: Q8NCW0-2) [UniParc]FASTAAdd to basket

Also known as: Kremen2a

The sequence of this isoform differs from the canonical sequence as follows:
     394-424: SCLLAPGKGPPALGASRGPRRSWAVWYQQPR → CGALGQGLRADRWWGAGAPEGNRARKELLGS
     425-462: Missing.

Show »
Length:424
Mass (Da):45,055
Checksum:i376B000839A519C4
GO
Isoform 3Curated (identifier: Q8NCW0-3) [UniParc]FASTAAdd to basket

Also known as: Kremen2b

The sequence of this isoform differs from the canonical sequence as follows:
     367-420: ARVFSTVTAV...GPRRSWAVWY → GAVCWLREKG...LRVLPRATGL
     421-462: Missing.

Show »
Length:420
Mass (Da):44,403
Checksum:i75C4479C67BA0D6E
GO
Isoform 4Curated (identifier: Q8NCW0-4) [UniParc]FASTAAdd to basket

Also known as: Kremen2c

The sequence of this isoform differs from the canonical sequence as follows:
     367-399: ARVFSTVTAVSVLLLLLLGLLRPLRRRSCLLAP → GEAGARDGSESGSRPLAPILTAAVCPQPGSSRR
     400-462: Missing.

Show »
Length:399
Mass (Da):42,037
Checksum:i5F677BDEBA72E0D3
GO
Isoform 5 (identifier: Q8NCW0-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-200: Missing.

Note: No experimental confirmation available.
Show »
Length:423
Mass (Da):44,880
Checksum:i47DB607DAAB94F9C
GO
Isoform 6 (identifier: Q8NCW0-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-200: Missing.
     367-462: ARVFSTVTAV...SSLRSLISAL → GAVCWLREKG...LRVLPRATGL

Note: No experimental confirmation available.
Show »
Length:381
Mass (Da):40,433
Checksum:i454966A1E691F3D0
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti164 – 20239Missing in BAC11365 (PubMed:14702039).CuratedAdd
BLAST
Sequence conflicti285 – 2851A → D in BAC11365 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti408 – 4081A → P.
Corresponds to variant rs11866302 [ dbSNP | Ensembl ].
VAR_059691

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei162 – 20039Missing in isoform 5 and isoform 6. 1 PublicationVSP_046399Add
BLAST
Alternative sequencei367 – 46296ARVFS…LISAL → GAVCWLREKGPRRWGLPGAP GEAGLCGTNSPEGWPCPAPP GTPRLRVLPRATGL in isoform 6. CuratedVSP_047386Add
BLAST
Alternative sequencei367 – 42054ARVFS…WAVWY → GAVCWLREKGPRRWGLPGAP GEAGLCGTNSPEGWPCPAPP GTPRLRVLPRATGL in isoform 3. 2 PublicationsVSP_050511Add
BLAST
Alternative sequencei367 – 39933ARVFS…CLLAP → GEAGARDGSESGSRPLAPIL TAAVCPQPGSSRR in isoform 4. 2 PublicationsVSP_050513Add
BLAST
Alternative sequencei394 – 42431SCLLA…YQQPR → CGALGQGLRADRWWGAGAPE GNRARKELLGS in isoform 2. CuratedVSP_050509Add
BLAST
Alternative sequencei400 – 46263Missing in isoform 4. 2 PublicationsVSP_050514Add
BLAST
Alternative sequencei421 – 46242Missing in isoform 3. 2 PublicationsVSP_050512Add
BLAST
Alternative sequencei425 – 46238Missing in isoform 2. CuratedVSP_050510Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB086405 mRNA. Translation: BAC00872.1.
AB086355 mRNA. Translation: BAC00823.1.
AB086356 mRNA. Translation: BAC00824.1.
AB086357 mRNA. Translation: BAC00825.1.
AK027669 mRNA. Translation: BAB55281.1.
AK075033 mRNA. Translation: BAC11365.1.
AK301953 mRNA. Translation: BAG63368.1.
AC004235 Genomic DNA. No translation available.
CH471112 Genomic DNA. Translation: EAW85449.1.
BC003533 mRNA. Translation: AAH03533.1.
BC009383 mRNA. Translation: AAH09383.1.
CCDSiCCDS10483.1. [Q8NCW0-1]
CCDS10484.1. [Q8NCW0-3]
CCDS58412.1. [Q8NCW0-5]
CCDS58413.1. [Q8NCW0-6]
RefSeqiNP_001240654.1. NM_001253725.1. [Q8NCW0-6]
NP_001240655.1. NM_001253726.1. [Q8NCW0-5]
NP_078783.1. NM_024507.3. [Q8NCW0-3]
NP_757384.1. NM_172229.2. [Q8NCW0-1]
UniGeneiHs.661128.

Genome annotation databases

EnsembliENST00000303746; ENSP00000304422; ENSG00000131650. [Q8NCW0-1]
ENST00000319500; ENSP00000322079; ENSG00000131650. [Q8NCW0-3]
ENST00000571007; ENSP00000461860; ENSG00000131650. [Q8NCW0-5]
ENST00000572045; ENSP00000460578; ENSG00000131650. [Q8NCW0-4]
ENST00000575769; ENSP00000460917; ENSG00000131650. [Q8NCW0-2]
ENST00000575885; ENSP00000459878; ENSG00000131650. [Q8NCW0-6]
GeneIDi79412.
KEGGihsa:79412.
UCSCiuc002csg.4. human. [Q8NCW0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB086405 mRNA. Translation: BAC00872.1.
AB086355 mRNA. Translation: BAC00823.1.
AB086356 mRNA. Translation: BAC00824.1.
AB086357 mRNA. Translation: BAC00825.1.
AK027669 mRNA. Translation: BAB55281.1.
AK075033 mRNA. Translation: BAC11365.1.
AK301953 mRNA. Translation: BAG63368.1.
AC004235 Genomic DNA. No translation available.
CH471112 Genomic DNA. Translation: EAW85449.1.
BC003533 mRNA. Translation: AAH03533.1.
BC009383 mRNA. Translation: AAH09383.1.
CCDSiCCDS10483.1. [Q8NCW0-1]
CCDS10484.1. [Q8NCW0-3]
CCDS58412.1. [Q8NCW0-5]
CCDS58413.1. [Q8NCW0-6]
RefSeqiNP_001240654.1. NM_001253725.1. [Q8NCW0-6]
NP_001240655.1. NM_001253726.1. [Q8NCW0-5]
NP_078783.1. NM_024507.3. [Q8NCW0-3]
NP_757384.1. NM_172229.2. [Q8NCW0-1]
UniGeneiHs.661128.

3D structure databases

ProteinModelPortaliQ8NCW0.
SMRiQ8NCW0. Positions 33-173, 219-323.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000304422.

PTM databases

iPTMnetiQ8NCW0.

Polymorphism and mutation databases

BioMutaiKREMEN2.
DMDMi30173086.

Proteomic databases

PaxDbiQ8NCW0.
PeptideAtlasiQ8NCW0.
PRIDEiQ8NCW0.

Protocols and materials databases

DNASUi79412.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000303746; ENSP00000304422; ENSG00000131650. [Q8NCW0-1]
ENST00000319500; ENSP00000322079; ENSG00000131650. [Q8NCW0-3]
ENST00000571007; ENSP00000461860; ENSG00000131650. [Q8NCW0-5]
ENST00000572045; ENSP00000460578; ENSG00000131650. [Q8NCW0-4]
ENST00000575769; ENSP00000460917; ENSG00000131650. [Q8NCW0-2]
ENST00000575885; ENSP00000459878; ENSG00000131650. [Q8NCW0-6]
GeneIDi79412.
KEGGihsa:79412.
UCSCiuc002csg.4. human. [Q8NCW0-1]

Organism-specific databases

CTDi79412.
GeneCardsiKREMEN2.
HGNCiHGNC:18797. KREMEN2.
HPAiHPA003223.
MIMi609899. gene.
neXtProtiNX_Q8NCW0.
PharmGKBiPA38683.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4157. Eukaryota.
ENOG4111FP9. LUCA.
GeneTreeiENSGT00730000110973.
HOGENOMiHOG000070150.
HOVERGENiHBG052291.
InParanoidiQ8NCW0.
OMAiVWYRRPR.
OrthoDBiEOG7T1RB2.
PhylomeDBiQ8NCW0.
TreeFamiTF331319.

Enzyme and pathway databases

ReactomeiR-HSA-201681. TCF dependent signaling in response to WNT.
R-HSA-3772470. Negative regulation of TCF-dependent signaling by WNT ligand antagonists.
R-HSA-5339717. Misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling.
SignaLinkiQ8NCW0.
SIGNORiQ8NCW0.

Miscellaneous databases

GenomeRNAii79412.
PROiQ8NCW0.
SOURCEiSearch...

Gene expression databases

BgeeiQ8NCW0.
CleanExiHS_KREMEN2.
ExpressionAtlasiQ8NCW0. baseline and differential.
GenevisibleiQ8NCW0. HS.

Family and domain databases

Gene3Di2.60.120.290. 1 hit.
InterProiIPR000859. CUB_dom.
IPR017076. Kremen.
IPR000001. Kringle.
IPR013806. Kringle-like.
IPR018056. Kringle_CS.
IPR002889. WSC_carb-bd.
[Graphical view]
PfamiPF00431. CUB. 1 hit.
PF00051. Kringle. 1 hit.
PF01822. WSC. 1 hit.
[Graphical view]
PIRSFiPIRSF036961. Kremen. 1 hit.
SMARTiSM00042. CUB. 1 hit.
SM00130. KR. 1 hit.
SM00321. WSC. 1 hit.
[Graphical view]
SUPFAMiSSF49854. SSF49854. 1 hit.
SSF57440. SSF57440. 1 hit.
PROSITEiPS01180. CUB. 1 hit.
PS00021. KRINGLE_1. 1 hit.
PS50070. KRINGLE_2. 1 hit.
PS51212. WSC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Human Kremen2 and Wnt signaling."
    Tanaka S., Sugimachi K.
    Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], ALTERNATIVE SPLICING.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4 AND 5).
    Tissue: Ovarian carcinoma and Testis.
  3. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Brain and Uterus.

Entry informationi

Entry nameiKREM2_HUMAN
AccessioniPrimary (citable) accession number: Q8NCW0
Secondary accession number(s): B4DXF6
, I3L2S2, Q8N2J4, Q8NCW1, Q96GL8, Q9BTP9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 23, 2003
Last sequence update: October 1, 2002
Last modified: July 6, 2016
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.