Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Adenosine deaminase domain-containing protein 2

Gene

ADAD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Adenosine deaminase domain-containing protein 2
Alternative name(s):
Testis nuclear RNA-binding protein-like
Gene namesi
Name:ADAD2
Synonyms:TENRL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000140955.10.
HGNCiHGNC:30714. ADAD2.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000140955.
PharmGKBiPA162375591.

Polymorphism and mutation databases

BioMutaiADAD2.
DMDMi74730183.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003095241 – 583Adenosine deaminase domain-containing protein 2Add BLAST583

Proteomic databases

PaxDbiQ8NCV1.
PeptideAtlasiQ8NCV1.
PRIDEiQ8NCV1.

PTM databases

iPTMnetiQ8NCV1.
PhosphoSitePlusiQ8NCV1.

Expressioni

Gene expression databases

BgeeiENSG00000140955.
CleanExiHS_ADAD2.
ExpressionAtlasiQ8NCV1. baseline and differential.
GenevisibleiQ8NCV1. HS.

Interactioni

Protein-protein interaction databases

BioGridi127807. 6 interactors.
STRINGi9606.ENSP00000268624.

Structurei

3D structure databases

ProteinModelPortaliQ8NCV1.
SMRiQ8NCV1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini115 – 181DRBMPROSITE-ProRule annotationAdd BLAST67
Domaini261 – 582A to I editasePROSITE-ProRule annotationAdd BLAST322

Sequence similaritiesi

Belongs to the ADAD family.Curated

Phylogenomic databases

eggNOGiKOG2777. Eukaryota.
ENOG410XT0Z. LUCA.
GeneTreeiENSGT00550000074412.
HOGENOMiHOG000033799.
HOVERGENiHBG101162.
InParanoidiQ8NCV1.
OMAiPCHDPPT.
OrthoDBiEOG091G04M6.
PhylomeDBiQ8NCV1.
TreeFamiTF315806.

Family and domain databases

InterProiView protein in InterPro
IPR002466. A_deamin.
IPR014720. dsRBD_dom.
PfamiView protein in Pfam
PF02137. A_deamin. 1 hit.
PF00035. dsrm. 1 hit.
SMARTiView protein in SMART
SM00552. ADEAMc. 1 hit.
PROSITEiView protein in PROSITE
PS50141. A_DEAMIN_EDITASE. 1 hit.
PS50137. DS_RBD. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NCV1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASASQGADD DGSRRKPRLA ASLQISPQPR PWRPLPAQAQ SAWGPAPAPA
60 70 80 90 100
TYRAEGGWPQ VSVLRDSGPG AGAGVGELGA ARAWENLGEQ MGKAPRVPVP
110 120 130 140 150
PAGLSLPLKD PPASQAVSLL TEYAASLGIF LLFREDQPPG PCFPFSVSAE
160 170 180 190 200
LDGVVCPAGT ANSKTEAKQQ AALSALCYIR SQLENPESPQ TSSRPPLAPL
210 220 230 240 250
SVENILTHEQ RCAALVSAGF DLLLDERSPY WACKGTVAGV ILEREIPRAR
260 270 280 290 300
GHVKEIYKLV ALGTGSSCCA GWLEFSGQQL HDCHGLVIAR RALLRFLFRQ
310 320 330 340 350
LLLATQGGPK GKEQSVLAPQ PGPGPPFTLK PRVFLHLYIS NTPKGAARDI
360 370 380 390 400
YLPPTSEGGL PHSPPMRLQA HVLGQLKPVC YVAPSLCDTH VGCLSASDKL
410 420 430 440 450
ARWAVLGLGG ALLAHLVSPL YSTSLILADS CHDPPTLSRA IHTRPCLDSV
460 470 480 490 500
LGPCLPPPYV RTALHLFAGP PVAPSEPTPD TCRGLSLNWS LGDPGIEVVD
510 520 530 540 550
VATGRVKANA ALGPPSRLCK ASFLRAFHQA ARAVGKPYLL ALKTYEAAKA
560 570 580
GPYQEARRQL SLLLDQQGLG AWPSKPLVGK FRN
Length:583
Mass (Da):61,755
Last modified:October 1, 2002 - v1
Checksum:i8F1566C88111FAD7
GO
Isoform 2 (identifier: Q8NCV1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     139-139: P → PGKVFKYRAPGGEELKAMCLWQVEVLRAFLLRTGWRGLWRGDLDLGPDSSWANRLPFLLICEMESRIPAVEEL
     244-244: R → RGWAVSAPSCT

Show »
Length:665
Mass (Da):70,989
Checksum:iC0E570BBE5F08016
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03697644G → E2 PublicationsCorresponds to variant dbSNP:rs8044695Ensembl.1
Natural variantiVAR_055650235G → R. Corresponds to variant dbSNP:rs11149631Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_029230139P → PGKVFKYRAPGGEELKAMCL WQVEVLRAFLLRTGWRGLWR GDLDLGPDSSWANRLPFLLI CEMESRIPAVEEL in isoform 2. 1 Publication1
Alternative sequenceiVSP_029231244R → RGWAVSAPSCT in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF447586 mRNA. Translation: AAM22869.1.
AK093046 mRNA. Translation: BAC04032.1.
AK315171 mRNA. Translation: BAG37613.1.
CH471114 Genomic DNA. Translation: EAW95491.1.
CH471114 Genomic DNA. Translation: EAW95492.1.
BC033491 mRNA. Translation: AAH33491.1.
CCDSiCCDS10944.1. [Q8NCV1-2]
CCDS45536.1. [Q8NCV1-1]
RefSeqiNP_001138872.1. NM_001145400.1. [Q8NCV1-1]
NP_631913.3. NM_139174.3. [Q8NCV1-2]
UniGeneiHs.8977.

Genome annotation databases

EnsembliENST00000268624; ENSP00000268624; ENSG00000140955. [Q8NCV1-2]
ENST00000315906; ENSP00000325153; ENSG00000140955. [Q8NCV1-1]
GeneIDi161931.
KEGGihsa:161931.
UCSCiuc002fhq.3. human. [Q8NCV1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiADAD2_HUMAN
AccessioniPrimary (citable) accession number: Q8NCV1
Secondary accession number(s): B2RCL6, Q8NA94
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: October 1, 2002
Last modified: September 27, 2017
This is version 109 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families