Q8NCV1 (ADAD2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 74.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Adenosine deaminase domain-containing protein 2 Alternative name(s): Testis nuclear RNA-binding protein-like | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 583 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Sequence similarities | Belongs to the ADAD family. Contains 1 A to I editase domain. Contains 1 DRBM (double-stranded RNA-binding) domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | RNA-binding |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | RNA processing Inferred from electronic annotation. Source: InterPro |
| Molecular_function | adenosine deaminase activity Inferred from electronic annotation. Source: InterPro double-stranded RNA bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NCV1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NCV1-2) The sequence of this isoform differs from the canonical sequence as follows: 139-139: P → PGKVFKYRAPGGEELKAMCLWQVEVLRAFLLRTGWRGLWRGDLDLGPDSSWANRLPFLLICEMESRIPAVEEL 244-244: R → RGWAVSAPSCT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 583 | 583 | Adenosine deaminase domain-containing protein 2 | PRO_0000309524 | |||||
Regions | |||||||||
| Domain | 115 – 181 | 67 | DRBM | ||||||
| Domain | 261 – 582 | 322 | A to I editase | ||||||
Natural variations | |||||||||
| Alternative sequence | 139 | 1 | P → PGKVFKYRAPGGEELKAMCL WQVEVLRAFLLRTGWRGLWR GDLDLGPDSSWANRLPFLLI CEMESRIPAVEEL in isoform 2. | VSP_029230 | |||||
| Alternative sequence | 244 | 1 | R → RGWAVSAPSCT in isoform 2. | VSP_029231 | |||||
| Natural variant | 44 | 1 | G → E. Ref.2 Ref.3 Corresponds to variant rs8044695 [ dbSNP | Ensembl ]. | VAR_036976 | |||||
| Natural variant | 235 | 1 | G → R. Corresponds to variant rs11149631 [ dbSNP | Ensembl ]. | VAR_055650 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | Guo J.H., Yu L. Submitted (OCT-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT GLU-44. Tissue: Testis. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-44. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF447586 mRNA. Translation: AAM22869.1. AK093046 mRNA. Translation: BAC04032.1. AK315171 mRNA. Translation: BAG37613.1. CH471114 Genomic DNA. Translation: EAW95491.1. CH471114 Genomic DNA. Translation: EAW95492.1. BC033491 mRNA. Translation: AAH33491.1. |
| IPI | IPI00168466. IPI00300468. |
| RefSeq | NP_001138872.1. NM_001145400.1. NP_631913.3. NM_139174.3. |
| UniGene | Hs.8977. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1ZY7 based on UniProtKB P78563. |
| ProteinModelPortal | Q8NCV1. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q8NCV1. |
Polymorphism databases | |
| DMDM | 74730183. |
Proteomic databases | |
| PaxDb | Q8NCV1. |
| PRIDE | Q8NCV1. |
Protocols and materials databases | |
| DNASU | 161931. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000268624; ENSP00000268624; ENSG00000140955. ENST00000315906; ENSP00000325153; ENSG00000140955. |
| GeneID | 161931. |
| KEGG | hsa:161931. |
| UCSC | uc002fhq.2. human. uc002fhr.2. human. |
Organism-specific databases | |
| CTD | 161931. |
| GeneCards | GC16P084224. |
| HGNC | HGNC:30714. ADAD2. |
| HPA | HPA043994. |
| neXtProt | NX_Q8NCV1. |
| PharmGKB | PA162375591. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG255519. |
| HOGENOM | HOG000033799. |
| HOVERGEN | HBG101162. |
| OMA | QRCAAVV. |
Gene expression databases | |
| ArrayExpress | Q8NCV1. |
| Bgee | Q8NCV1. |
| CleanEx | HS_ADAD2. |
| Genevestigator | Q8NCV1. |
Family and domain databases | |
| Gene3D | 3.30.160.20. 1 hit. |
| InterPro | IPR002466. A_deamin. IPR001159. Ds-RNA-bd. IPR014720. dsRNA-bd-like_dom. [Graphical view] |
| Pfam | PF02137. A_deamin. 1 hit. PF00035. dsrm. 1 hit. [Graphical view] |
| SMART | SM00358. DSRM. 1 hit. [Graphical view] |
| PROSITE | PS50141. A_DEAMIN_EDITASE. 1 hit. PS50137. DS_RBD. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 161931. |
| NextBio | 88130. |
Entry information
| Entry name | ADAD2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NCV1 Secondary accession number(s): B2RCL6, Q8NA94 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
