Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NCV1

- ADAD2_HUMAN

UniProt

Q8NCV1 - ADAD2_HUMAN

Protein

Adenosine deaminase domain-containing protein 2

Gene

ADAD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 1 (01 Oct 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. adenosine deaminase activity Source: InterPro
    2. RNA binding Source: UniProtKB-KW

    GO - Biological processi

    1. RNA processing Source: InterPro

    Keywords - Ligandi

    RNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Adenosine deaminase domain-containing protein 2
    Alternative name(s):
    Testis nuclear RNA-binding protein-like
    Gene namesi
    Name:ADAD2
    Synonyms:TENRL
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:30714. ADAD2.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162375591.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 583583Adenosine deaminase domain-containing protein 2PRO_0000309524Add
    BLAST

    Proteomic databases

    PaxDbiQ8NCV1.
    PRIDEiQ8NCV1.

    PTM databases

    PhosphoSiteiQ8NCV1.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8NCV1.
    BgeeiQ8NCV1.
    CleanExiHS_ADAD2.
    GenevestigatoriQ8NCV1.

    Organism-specific databases

    HPAiHPA043994.

    Interactioni

    Protein-protein interaction databases

    BioGridi127807. 1 interaction.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NCV1.
    SMRiQ8NCV1. Positions 113-182, 193-576.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini115 – 18167DRBMPROSITE-ProRule annotationAdd
    BLAST
    Domaini261 – 582322A to I editasePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the ADAD family.Curated
    Contains 1 A to I editase domain.PROSITE-ProRule annotation
    Contains 1 DRBM (double-stranded RNA-binding) domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG255519.
    HOGENOMiHOG000033799.
    HOVERGENiHBG101162.
    OMAiCKGTVAA.
    OrthoDBiEOG7MH0XW.
    PhylomeDBiQ8NCV1.
    TreeFamiTF315806.

    Family and domain databases

    Gene3Di3.30.160.20. 1 hit.
    InterProiIPR002466. A_deamin.
    IPR014720. dsRNA-bd_dom.
    [Graphical view]
    PfamiPF02137. A_deamin. 1 hit.
    PF00035. dsrm. 1 hit.
    [Graphical view]
    SMARTiSM00358. DSRM. 1 hit.
    [Graphical view]
    PROSITEiPS50141. A_DEAMIN_EDITASE. 1 hit.
    PS50137. DS_RBD. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NCV1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASASQGADD DGSRRKPRLA ASLQISPQPR PWRPLPAQAQ SAWGPAPAPA    50
    TYRAEGGWPQ VSVLRDSGPG AGAGVGELGA ARAWENLGEQ MGKAPRVPVP 100
    PAGLSLPLKD PPASQAVSLL TEYAASLGIF LLFREDQPPG PCFPFSVSAE 150
    LDGVVCPAGT ANSKTEAKQQ AALSALCYIR SQLENPESPQ TSSRPPLAPL 200
    SVENILTHEQ RCAALVSAGF DLLLDERSPY WACKGTVAGV ILEREIPRAR 250
    GHVKEIYKLV ALGTGSSCCA GWLEFSGQQL HDCHGLVIAR RALLRFLFRQ 300
    LLLATQGGPK GKEQSVLAPQ PGPGPPFTLK PRVFLHLYIS NTPKGAARDI 350
    YLPPTSEGGL PHSPPMRLQA HVLGQLKPVC YVAPSLCDTH VGCLSASDKL 400
    ARWAVLGLGG ALLAHLVSPL YSTSLILADS CHDPPTLSRA IHTRPCLDSV 450
    LGPCLPPPYV RTALHLFAGP PVAPSEPTPD TCRGLSLNWS LGDPGIEVVD 500
    VATGRVKANA ALGPPSRLCK ASFLRAFHQA ARAVGKPYLL ALKTYEAAKA 550
    GPYQEARRQL SLLLDQQGLG AWPSKPLVGK FRN 583
    Length:583
    Mass (Da):61,755
    Last modified:October 1, 2002 - v1
    Checksum:i8F1566C88111FAD7
    GO
    Isoform 2 (identifier: Q8NCV1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         139-139: P → PGKVFKYRAPGGEELKAMCLWQVEVLRAFLLRTGWRGLWRGDLDLGPDSSWANRLPFLLICEMESRIPAVEEL
         244-244: R → RGWAVSAPSCT

    Show »
    Length:665
    Mass (Da):70,989
    Checksum:iC0E570BBE5F08016
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti44 – 441G → E.2 Publications
    Corresponds to variant rs8044695 [ dbSNP | Ensembl ].
    VAR_036976
    Natural varianti235 – 2351G → R.
    Corresponds to variant rs11149631 [ dbSNP | Ensembl ].
    VAR_055650

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei139 – 1391P → PGKVFKYRAPGGEELKAMCL WQVEVLRAFLLRTGWRGLWR GDLDLGPDSSWANRLPFLLI CEMESRIPAVEEL in isoform 2. 1 PublicationVSP_029230
    Alternative sequencei244 – 2441R → RGWAVSAPSCT in isoform 2. 1 PublicationVSP_029231

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF447586 mRNA. Translation: AAM22869.1.
    AK093046 mRNA. Translation: BAC04032.1.
    AK315171 mRNA. Translation: BAG37613.1.
    CH471114 Genomic DNA. Translation: EAW95491.1.
    CH471114 Genomic DNA. Translation: EAW95492.1.
    BC033491 mRNA. Translation: AAH33491.1.
    CCDSiCCDS10944.1. [Q8NCV1-2]
    CCDS45536.1. [Q8NCV1-1]
    RefSeqiNP_001138872.1. NM_001145400.1. [Q8NCV1-1]
    NP_631913.3. NM_139174.3. [Q8NCV1-2]
    UniGeneiHs.8977.

    Genome annotation databases

    EnsembliENST00000268624; ENSP00000268624; ENSG00000140955. [Q8NCV1-2]
    ENST00000315906; ENSP00000325153; ENSG00000140955. [Q8NCV1-1]
    GeneIDi161931.
    KEGGihsa:161931.
    UCSCiuc002fhq.2. human. [Q8NCV1-2]
    uc002fhr.2. human. [Q8NCV1-1]

    Polymorphism databases

    DMDMi74730183.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF447586 mRNA. Translation: AAM22869.1 .
    AK093046 mRNA. Translation: BAC04032.1 .
    AK315171 mRNA. Translation: BAG37613.1 .
    CH471114 Genomic DNA. Translation: EAW95491.1 .
    CH471114 Genomic DNA. Translation: EAW95492.1 .
    BC033491 mRNA. Translation: AAH33491.1 .
    CCDSi CCDS10944.1. [Q8NCV1-2 ]
    CCDS45536.1. [Q8NCV1-1 ]
    RefSeqi NP_001138872.1. NM_001145400.1. [Q8NCV1-1 ]
    NP_631913.3. NM_139174.3. [Q8NCV1-2 ]
    UniGenei Hs.8977.

    3D structure databases

    ProteinModelPortali Q8NCV1.
    SMRi Q8NCV1. Positions 113-182, 193-576.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127807. 1 interaction.

    PTM databases

    PhosphoSitei Q8NCV1.

    Polymorphism databases

    DMDMi 74730183.

    Proteomic databases

    PaxDbi Q8NCV1.
    PRIDEi Q8NCV1.

    Protocols and materials databases

    DNASUi 161931.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000268624 ; ENSP00000268624 ; ENSG00000140955 . [Q8NCV1-2 ]
    ENST00000315906 ; ENSP00000325153 ; ENSG00000140955 . [Q8NCV1-1 ]
    GeneIDi 161931.
    KEGGi hsa:161931.
    UCSCi uc002fhq.2. human. [Q8NCV1-2 ]
    uc002fhr.2. human. [Q8NCV1-1 ]

    Organism-specific databases

    CTDi 161931.
    GeneCardsi GC16P084224.
    HGNCi HGNC:30714. ADAD2.
    HPAi HPA043994.
    neXtProti NX_Q8NCV1.
    PharmGKBi PA162375591.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG255519.
    HOGENOMi HOG000033799.
    HOVERGENi HBG101162.
    OMAi CKGTVAA.
    OrthoDBi EOG7MH0XW.
    PhylomeDBi Q8NCV1.
    TreeFami TF315806.

    Miscellaneous databases

    GenomeRNAii 161931.
    NextBioi 88130.
    PROi Q8NCV1.

    Gene expression databases

    ArrayExpressi Q8NCV1.
    Bgeei Q8NCV1.
    CleanExi HS_ADAD2.
    Genevestigatori Q8NCV1.

    Family and domain databases

    Gene3Di 3.30.160.20. 1 hit.
    InterProi IPR002466. A_deamin.
    IPR014720. dsRNA-bd_dom.
    [Graphical view ]
    Pfami PF02137. A_deamin. 1 hit.
    PF00035. dsrm. 1 hit.
    [Graphical view ]
    SMARTi SM00358. DSRM. 1 hit.
    [Graphical view ]
    PROSITEi PS50141. A_DEAMIN_EDITASE. 1 hit.
    PS50137. DS_RBD. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Guo J.H., Yu L.
      Submitted (OCT-2001) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT GLU-44.
      Tissue: Testis.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-44.
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.

    Entry informationi

    Entry nameiADAD2_HUMAN
    AccessioniPrimary (citable) accession number: Q8NCV1
    Secondary accession number(s): B2RCL6, Q8NA94
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 13, 2007
    Last sequence update: October 1, 2002
    Last modified: October 1, 2014
    This is version 87 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3