Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NCV1 (ADAD2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 83. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Adenosine deaminase domain-containing protein 2
Alternative name(s):
Testis nuclear RNA-binding protein-like
Gene names
Name:ADAD2
Synonyms:TENRL
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length583 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence similarities

Belongs to the ADAD family.

Contains 1 A to I editase domain.

Contains 1 DRBM (double-stranded RNA-binding) domain.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandRNA-binding
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processRNA processing

Inferred from electronic annotation. Source: InterPro

   Molecular_functionRNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

adenosine deaminase activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8NCV1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8NCV1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     139-139: P → PGKVFKYRAPGGEELKAMCLWQVEVLRAFLLRTGWRGLWRGDLDLGPDSSWANRLPFLLICEMESRIPAVEEL
     244-244: R → RGWAVSAPSCT

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 583583Adenosine deaminase domain-containing protein 2
PRO_0000309524

Regions

Domain115 – 18167DRBM
Domain261 – 582322A to I editase

Natural variations

Alternative sequence1391P → PGKVFKYRAPGGEELKAMCL WQVEVLRAFLLRTGWRGLWR GDLDLGPDSSWANRLPFLLI CEMESRIPAVEEL in isoform 2.
VSP_029230
Alternative sequence2441R → RGWAVSAPSCT in isoform 2.
VSP_029231
Natural variant441G → E. Ref.2 Ref.3
Corresponds to variant rs8044695 [ dbSNP | Ensembl ].
VAR_036976
Natural variant2351G → R.
Corresponds to variant rs11149631 [ dbSNP | Ensembl ].
VAR_055650

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2002. Version 1.
Checksum: 8F1566C88111FAD7

FASTA58361,755
        10         20         30         40         50         60 
MASASQGADD DGSRRKPRLA ASLQISPQPR PWRPLPAQAQ SAWGPAPAPA TYRAEGGWPQ 

        70         80         90        100        110        120 
VSVLRDSGPG AGAGVGELGA ARAWENLGEQ MGKAPRVPVP PAGLSLPLKD PPASQAVSLL 

       130        140        150        160        170        180 
TEYAASLGIF LLFREDQPPG PCFPFSVSAE LDGVVCPAGT ANSKTEAKQQ AALSALCYIR 

       190        200        210        220        230        240 
SQLENPESPQ TSSRPPLAPL SVENILTHEQ RCAALVSAGF DLLLDERSPY WACKGTVAGV 

       250        260        270        280        290        300 
ILEREIPRAR GHVKEIYKLV ALGTGSSCCA GWLEFSGQQL HDCHGLVIAR RALLRFLFRQ 

       310        320        330        340        350        360 
LLLATQGGPK GKEQSVLAPQ PGPGPPFTLK PRVFLHLYIS NTPKGAARDI YLPPTSEGGL 

       370        380        390        400        410        420 
PHSPPMRLQA HVLGQLKPVC YVAPSLCDTH VGCLSASDKL ARWAVLGLGG ALLAHLVSPL 

       430        440        450        460        470        480 
YSTSLILADS CHDPPTLSRA IHTRPCLDSV LGPCLPPPYV RTALHLFAGP PVAPSEPTPD 

       490        500        510        520        530        540 
TCRGLSLNWS LGDPGIEVVD VATGRVKANA ALGPPSRLCK ASFLRAFHQA ARAVGKPYLL 

       550        560        570        580 
ALKTYEAAKA GPYQEARRQL SLLLDQQGLG AWPSKPLVGK FRN 

« Hide

Isoform 2 [UniParc].

Checksum: C0E570BBE5F08016
Show »

FASTA66570,989

References

[1]Guo J.H., Yu L.
Submitted (OCT-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Testis.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT GLU-44.
Tissue: Testis.
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-44.
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF447586 mRNA. Translation: AAM22869.1.
AK093046 mRNA. Translation: BAC04032.1.
AK315171 mRNA. Translation: BAG37613.1.
CH471114 Genomic DNA. Translation: EAW95491.1.
CH471114 Genomic DNA. Translation: EAW95492.1.
BC033491 mRNA. Translation: AAH33491.1.
RefSeqNP_001138872.1. NM_001145400.1.
NP_631913.3. NM_139174.3.
UniGeneHs.8977.

3D structure databases

ProteinModelPortalQ8NCV1.
SMRQ8NCV1. Positions 109-186, 193-576.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid127807. 1 interaction.

PTM databases

PhosphoSiteQ8NCV1.

Polymorphism databases

DMDM74730183.

Proteomic databases

PaxDbQ8NCV1.
PRIDEQ8NCV1.

Protocols and materials databases

DNASU161931.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000268624; ENSP00000268624; ENSG00000140955. [Q8NCV1-2]
ENST00000315906; ENSP00000325153; ENSG00000140955. [Q8NCV1-1]
GeneID161931.
KEGGhsa:161931.
UCSCuc002fhq.2. human. [Q8NCV1-2]
uc002fhr.2. human. [Q8NCV1-1]

Organism-specific databases

CTD161931.
GeneCardsGC16P084224.
HGNCHGNC:30714. ADAD2.
HPAHPA043994.
neXtProtNX_Q8NCV1.
PharmGKBPA162375591.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG255519.
HOGENOMHOG000033799.
HOVERGENHBG101162.
OMACKGTVAA.
OrthoDBEOG7MH0XW.
PhylomeDBQ8NCV1.
TreeFamTF315806.

Gene expression databases

ArrayExpressQ8NCV1.
BgeeQ8NCV1.
CleanExHS_ADAD2.
GenevestigatorQ8NCV1.

Family and domain databases

Gene3D3.30.160.20. 1 hit.
InterProIPR002466. A_deamin.
IPR014720. dsRNA-bd_dom.
[Graphical view]
PfamPF02137. A_deamin. 1 hit.
PF00035. dsrm. 1 hit.
[Graphical view]
SMARTSM00358. DSRM. 1 hit.
[Graphical view]
PROSITEPS50141. A_DEAMIN_EDITASE. 1 hit.
PS50137. DS_RBD. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi161931.
NextBio88130.
PROQ8NCV1.

Entry information

Entry nameADAD2_HUMAN
AccessionPrimary (citable) accession number: Q8NCV1
Secondary accession number(s): B2RCL6, Q8NA94
Entry history
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: October 1, 2002
Last modified: April 16, 2014
This is version 83 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM