Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NCV1

- ADAD2_HUMAN

UniProt

Q8NCV1 - ADAD2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Adenosine deaminase domain-containing protein 2

Gene

ADAD2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. adenosine deaminase activity Source: InterPro
  2. RNA binding Source: UniProtKB-KW

GO - Biological processi

  1. RNA processing Source: InterPro
Complete GO annotation...

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Adenosine deaminase domain-containing protein 2
Alternative name(s):
Testis nuclear RNA-binding protein-like
Gene namesi
Name:ADAD2
Synonyms:TENRL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:30714. ADAD2.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162375591.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 583583Adenosine deaminase domain-containing protein 2PRO_0000309524Add
BLAST

Proteomic databases

PaxDbiQ8NCV1.
PRIDEiQ8NCV1.

PTM databases

PhosphoSiteiQ8NCV1.

Expressioni

Gene expression databases

BgeeiQ8NCV1.
CleanExiHS_ADAD2.
ExpressionAtlasiQ8NCV1. baseline.
GenevestigatoriQ8NCV1.

Organism-specific databases

HPAiHPA043994.

Interactioni

Protein-protein interaction databases

BioGridi127807. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ8NCV1.
SMRiQ8NCV1. Positions 193-576.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini115 – 18167DRBMPROSITE-ProRule annotationAdd
BLAST
Domaini261 – 582322A to I editasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the ADAD family.Curated
Contains 1 A to I editase domain.PROSITE-ProRule annotation
Contains 1 DRBM (double-stranded RNA-binding) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG255519.
GeneTreeiENSGT00550000074412.
HOGENOMiHOG000033799.
HOVERGENiHBG101162.
InParanoidiQ8NCV1.
OMAiCKGTVAA.
OrthoDBiEOG7MH0XW.
PhylomeDBiQ8NCV1.
TreeFamiTF315806.

Family and domain databases

Gene3Di3.30.160.20. 1 hit.
InterProiIPR002466. A_deamin.
IPR014720. dsRNA-bd_dom.
[Graphical view]
PfamiPF02137. A_deamin. 1 hit.
PF00035. dsrm. 1 hit.
[Graphical view]
SMARTiSM00358. DSRM. 1 hit.
[Graphical view]
PROSITEiPS50141. A_DEAMIN_EDITASE. 1 hit.
PS50137. DS_RBD. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8NCV1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASASQGADD DGSRRKPRLA ASLQISPQPR PWRPLPAQAQ SAWGPAPAPA
60 70 80 90 100
TYRAEGGWPQ VSVLRDSGPG AGAGVGELGA ARAWENLGEQ MGKAPRVPVP
110 120 130 140 150
PAGLSLPLKD PPASQAVSLL TEYAASLGIF LLFREDQPPG PCFPFSVSAE
160 170 180 190 200
LDGVVCPAGT ANSKTEAKQQ AALSALCYIR SQLENPESPQ TSSRPPLAPL
210 220 230 240 250
SVENILTHEQ RCAALVSAGF DLLLDERSPY WACKGTVAGV ILEREIPRAR
260 270 280 290 300
GHVKEIYKLV ALGTGSSCCA GWLEFSGQQL HDCHGLVIAR RALLRFLFRQ
310 320 330 340 350
LLLATQGGPK GKEQSVLAPQ PGPGPPFTLK PRVFLHLYIS NTPKGAARDI
360 370 380 390 400
YLPPTSEGGL PHSPPMRLQA HVLGQLKPVC YVAPSLCDTH VGCLSASDKL
410 420 430 440 450
ARWAVLGLGG ALLAHLVSPL YSTSLILADS CHDPPTLSRA IHTRPCLDSV
460 470 480 490 500
LGPCLPPPYV RTALHLFAGP PVAPSEPTPD TCRGLSLNWS LGDPGIEVVD
510 520 530 540 550
VATGRVKANA ALGPPSRLCK ASFLRAFHQA ARAVGKPYLL ALKTYEAAKA
560 570 580
GPYQEARRQL SLLLDQQGLG AWPSKPLVGK FRN
Length:583
Mass (Da):61,755
Last modified:October 1, 2002 - v1
Checksum:i8F1566C88111FAD7
GO
Isoform 2 (identifier: Q8NCV1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     139-139: P → PGKVFKYRAPGGEELKAMCLWQVEVLRAFLLRTGWRGLWRGDLDLGPDSSWANRLPFLLICEMESRIPAVEEL
     244-244: R → RGWAVSAPSCT

Show »
Length:665
Mass (Da):70,989
Checksum:iC0E570BBE5F08016
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti44 – 441G → E.2 Publications
Corresponds to variant rs8044695 [ dbSNP | Ensembl ].
VAR_036976
Natural varianti235 – 2351G → R.
Corresponds to variant rs11149631 [ dbSNP | Ensembl ].
VAR_055650

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei139 – 1391P → PGKVFKYRAPGGEELKAMCL WQVEVLRAFLLRTGWRGLWR GDLDLGPDSSWANRLPFLLI CEMESRIPAVEEL in isoform 2. 1 PublicationVSP_029230
Alternative sequencei244 – 2441R → RGWAVSAPSCT in isoform 2. 1 PublicationVSP_029231

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF447586 mRNA. Translation: AAM22869.1.
AK093046 mRNA. Translation: BAC04032.1.
AK315171 mRNA. Translation: BAG37613.1.
CH471114 Genomic DNA. Translation: EAW95491.1.
CH471114 Genomic DNA. Translation: EAW95492.1.
BC033491 mRNA. Translation: AAH33491.1.
CCDSiCCDS10944.1. [Q8NCV1-2]
CCDS45536.1. [Q8NCV1-1]
RefSeqiNP_001138872.1. NM_001145400.1. [Q8NCV1-1]
NP_631913.3. NM_139174.3. [Q8NCV1-2]
UniGeneiHs.8977.

Genome annotation databases

EnsembliENST00000268624; ENSP00000268624; ENSG00000140955. [Q8NCV1-2]
ENST00000315906; ENSP00000325153; ENSG00000140955. [Q8NCV1-1]
GeneIDi161931.
KEGGihsa:161931.
UCSCiuc002fhq.2. human. [Q8NCV1-2]
uc002fhr.2. human. [Q8NCV1-1]

Polymorphism databases

DMDMi74730183.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF447586 mRNA. Translation: AAM22869.1 .
AK093046 mRNA. Translation: BAC04032.1 .
AK315171 mRNA. Translation: BAG37613.1 .
CH471114 Genomic DNA. Translation: EAW95491.1 .
CH471114 Genomic DNA. Translation: EAW95492.1 .
BC033491 mRNA. Translation: AAH33491.1 .
CCDSi CCDS10944.1. [Q8NCV1-2 ]
CCDS45536.1. [Q8NCV1-1 ]
RefSeqi NP_001138872.1. NM_001145400.1. [Q8NCV1-1 ]
NP_631913.3. NM_139174.3. [Q8NCV1-2 ]
UniGenei Hs.8977.

3D structure databases

ProteinModelPortali Q8NCV1.
SMRi Q8NCV1. Positions 193-576.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127807. 1 interaction.

PTM databases

PhosphoSitei Q8NCV1.

Polymorphism databases

DMDMi 74730183.

Proteomic databases

PaxDbi Q8NCV1.
PRIDEi Q8NCV1.

Protocols and materials databases

DNASUi 161931.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000268624 ; ENSP00000268624 ; ENSG00000140955 . [Q8NCV1-2 ]
ENST00000315906 ; ENSP00000325153 ; ENSG00000140955 . [Q8NCV1-1 ]
GeneIDi 161931.
KEGGi hsa:161931.
UCSCi uc002fhq.2. human. [Q8NCV1-2 ]
uc002fhr.2. human. [Q8NCV1-1 ]

Organism-specific databases

CTDi 161931.
GeneCardsi GC16P084224.
HGNCi HGNC:30714. ADAD2.
HPAi HPA043994.
neXtProti NX_Q8NCV1.
PharmGKBi PA162375591.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG255519.
GeneTreei ENSGT00550000074412.
HOGENOMi HOG000033799.
HOVERGENi HBG101162.
InParanoidi Q8NCV1.
OMAi CKGTVAA.
OrthoDBi EOG7MH0XW.
PhylomeDBi Q8NCV1.
TreeFami TF315806.

Miscellaneous databases

GenomeRNAii 161931.
NextBioi 88130.
PROi Q8NCV1.

Gene expression databases

Bgeei Q8NCV1.
CleanExi HS_ADAD2.
ExpressionAtlasi Q8NCV1. baseline.
Genevestigatori Q8NCV1.

Family and domain databases

Gene3Di 3.30.160.20. 1 hit.
InterProi IPR002466. A_deamin.
IPR014720. dsRNA-bd_dom.
[Graphical view ]
Pfami PF02137. A_deamin. 1 hit.
PF00035. dsrm. 1 hit.
[Graphical view ]
SMARTi SM00358. DSRM. 1 hit.
[Graphical view ]
PROSITEi PS50141. A_DEAMIN_EDITASE. 1 hit.
PS50137. DS_RBD. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. Guo J.H., Yu L.
    Submitted (OCT-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT GLU-44.
    Tissue: Testis.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT GLU-44.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiADAD2_HUMAN
AccessioniPrimary (citable) accession number: Q8NCV1
Secondary accession number(s): B2RCL6, Q8NA94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: October 1, 2002
Last modified: October 29, 2014
This is version 88 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3