Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein KIAA0895

Gene

KIAA0895

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein KIAA0895
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:22206. KIAA0895.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164721801.

Polymorphism and mutation databases

BioMutaiKIAA0895.
DMDMi172045806.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 520520Uncharacterized protein KIAA0895PRO_0000320617Add
BLAST

Proteomic databases

EPDiQ8NCT3.
MaxQBiQ8NCT3.
PaxDbiQ8NCT3.
PRIDEiQ8NCT3.

PTM databases

iPTMnetiQ8NCT3.
PhosphoSiteiQ8NCT3.

Expressioni

Gene expression databases

BgeeiQ8NCT3.
ExpressionAtlasiQ8NCT3. baseline and differential.
GenevisibleiQ8NCT3. HS.

Organism-specific databases

HPAiHPA020512.
HPA021036.

Interactioni

Protein-protein interaction databases

BioGridi116946. 1 interaction.

Structurei

3D structure databases

ProteinModelPortaliQ8NCT3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi12 – 5140Arg-richAdd
BLAST

Phylogenomic databases

eggNOGiENOG410IGSS. Eukaryota.
ENOG410YKC2. LUCA.
GeneTreeiENSGT00390000004417.
HOGENOMiHOG000069902.
HOVERGENiHBG067127.
InParanoidiQ8NCT3.
OMAiMKEGCLG.
PhylomeDBiQ8NCT3.
TreeFamiTF329621.

Family and domain databases

InterProiIPR012548. DUF1704.
[Graphical view]
PfamiPF08014. DUF1704. 1 hit.
[Graphical view]
SMARTiSM01154. DUF1704. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NCT3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGCTRKLTH LRKRIHRPRR RTTRRWKRWF KFRKRKGEKR PRPNHKAVAR
60 70 80 90 100
RAKLKFSTSE KLHWPEQELA KKSILNAEDS LIIDNKRSIS HLSSGVLKDI
110 120 130 140 150
FTTGTSSYNV LLQSKEEKKY HSQKQSSSTY SKRCRKPSKS PNTSRSKDPR
160 170 180 190 200
RMKALVPVTS SGTWYCLERR PAVFVTSSVS SPVKFTHDIS VTGNGIVLPP
210 220 230 240 250
KPKSKVKWCH FSTLPKPKPQ LSRSFEKGDD FSGKKFCILT AIKPTNLEKE
260 270 280 290 300
KLRFFKSDYT YNPQFEYANP ALPSVLAKHS HASDRFLKQI VVHLTEDLLS
310 320 330 340 350
RASMTVVNGC PTLTINVSTA REHWLEGMLR HEIGTHYFRG INNLQQPWNS
360 370 380 390 400
WTGRKKHELK PNNPTEEGLA SIHSVLFRKD PFLWRAALLY YTVYQASQMS
410 420 430 440 450
FCELFKDIGR FVKDPNTRWD YCVRAKRGWT DTSQPGCFSK DQVYLDGILQ
460 470 480 490 500
ILRYRDTIDF HLLTALGKVS YEDVDRLKGL AVTENMRVPH FLQDHGRYME
510 520
HLEKIMEVNE LTDRELKDLI
Length:520
Mass (Da):60,525
Last modified:February 26, 2008 - v4
Checksum:i1803AA8CB1D8FC44
GO
Isoform 2 (identifier: Q8NCT3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAGCTRKLTH...RAKLKFSTSE → MVATGWARRS...PLILSSLIIK

Note: No experimental confirmation available.
Show »
Length:507
Mass (Da):58,304
Checksum:iDBEA7A2FA1089549
GO
Isoform 3 (identifier: Q8NCT3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MAGCTRKLTHLRKRIHRPRRRTTRRWKRWFKFRKRKGEKRPRPNHKAVARRAKLKFSTS → MLESIRVT

Show »
Length:469
Mass (Da):54,050
Checksum:i4ACBBE723E89EE1A
GO
Isoform 4 (identifier: Q8NCT3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAGCTRKLTH...RAKLKFSTSE → MVATGWARRS...PLILSSLIIK
     290-520: IVVHLTEDLL...LTDRELKDLI → VKCHFNSGSSFLCTKTIICDLISKNKDI

Note: No experimental confirmation available.
Show »
Length:304
Mass (Da):34,377
Checksum:i068946E2C006F2CC
GO
Isoform 5 (identifier: Q8NCT3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.
     289-289: Q → QSINIMELTLQKYGSYEKFEQATGGSLLSKTRIWSHVRKYMMKEGCLGE

Note: No experimental confirmation available.
Show »
Length:417
Mass (Da):48,113
Checksum:iA5BF78777232B5D5
GO
Isoform 6 (identifier: Q8NCT3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-59: MAGCTRKLTHLRKRIHRPRRRTTRRWKRWFKFRKRKGEKRPRPNHKAVARRAKLKFSTS → MLESIRVT
     289-289: Q → QSINIMELTLQKYGSYEKFEQATGGSLLSKTRIWSHVRKYMMKEGCLGE

Note: No experimental confirmation available.
Show »
Length:517
Mass (Da):59,575
Checksum:iC4292015EC48DB42
GO

Sequence cautioni

The sequence BAA74918.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti117 – 1171E → K in BAA74918 (PubMed:10048485).Curated
Sequence conflicti281 – 2822HA → P in AAH28678 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 151151Missing in isoform 5. 1 PublicationVSP_043322Add
BLAST
Alternative sequencei1 – 6060MAGCT…FSTSE → MVATGWARRSGLHPAPRPLR GAQEALAKNLWREERNRPLI LSSLIIK in isoform 2 and isoform 4. 1 PublicationVSP_031685Add
BLAST
Alternative sequencei1 – 5959MAGCT…KFSTS → MLESIRVT in isoform 3 and isoform 6. 2 PublicationsVSP_031686Add
BLAST
Alternative sequencei289 – 2891Q → QSINIMELTLQKYGSYEKFE QATGGSLLSKTRIWSHVRKY MMKEGCLGE in isoform 5 and isoform 6. 2 PublicationsVSP_043323
Alternative sequencei290 – 520231IVVHL…LKDLI → VKCHFNSGSSFLCTKTIICD LISKNKDI in isoform 4. 1 PublicationVSP_031687Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB020702 mRNA. Translation: BAA74918.1. Different initiation.
AK293912 mRNA. Translation: BAG57296.1.
AC006960 Genomic DNA. No translation available.
BC028678 mRNA. Translation: AAH28678.3.
BC056191 mRNA. Translation: AAH56191.2.
BC110422 mRNA. Translation: AAI10423.1.
BC136362 mRNA. Translation: AAI36363.1.
BC144032 mRNA. Translation: AAI44033.1.
CCDSiCCDS43570.1. [Q8NCT3-1]
CCDS47573.1. [Q8NCT3-3]
CCDS56482.1. [Q8NCT3-5]
CCDS56483.1. [Q8NCT3-2]
CCDS56484.1. [Q8NCT3-6]
RefSeqiNP_001093895.1. NM_001100425.1. [Q8NCT3-1]
NP_001186635.1. NM_001199706.1. [Q8NCT3-6]
NP_001186636.1. NM_001199707.1. [Q8NCT3-2]
NP_001186637.1. NM_001199708.1. [Q8NCT3-5]
NP_056129.2. NM_015314.2. [Q8NCT3-3]
UniGeneiHs.6224.
Hs.735371.

Genome annotation databases

EnsembliENST00000297063; ENSP00000297063; ENSG00000164542. [Q8NCT3-1]
ENST00000317020; ENSP00000319251; ENSG00000164542. [Q8NCT3-3]
ENST00000338533; ENSP00000344805; ENSG00000164542. [Q8NCT3-2]
ENST00000415803; ENSP00000400749; ENSG00000164542. [Q8NCT3-4]
ENST00000436884; ENSP00000389985; ENSG00000164542. [Q8NCT3-5]
ENST00000440378; ENSP00000390837; ENSG00000164542. [Q8NCT3-6]
GeneIDi23366.
KEGGihsa:23366.
UCSCiuc003tfb.3. human. [Q8NCT3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB020702 mRNA. Translation: BAA74918.1. Different initiation.
AK293912 mRNA. Translation: BAG57296.1.
AC006960 Genomic DNA. No translation available.
BC028678 mRNA. Translation: AAH28678.3.
BC056191 mRNA. Translation: AAH56191.2.
BC110422 mRNA. Translation: AAI10423.1.
BC136362 mRNA. Translation: AAI36363.1.
BC144032 mRNA. Translation: AAI44033.1.
CCDSiCCDS43570.1. [Q8NCT3-1]
CCDS47573.1. [Q8NCT3-3]
CCDS56482.1. [Q8NCT3-5]
CCDS56483.1. [Q8NCT3-2]
CCDS56484.1. [Q8NCT3-6]
RefSeqiNP_001093895.1. NM_001100425.1. [Q8NCT3-1]
NP_001186635.1. NM_001199706.1. [Q8NCT3-6]
NP_001186636.1. NM_001199707.1. [Q8NCT3-2]
NP_001186637.1. NM_001199708.1. [Q8NCT3-5]
NP_056129.2. NM_015314.2. [Q8NCT3-3]
UniGeneiHs.6224.
Hs.735371.

3D structure databases

ProteinModelPortaliQ8NCT3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116946. 1 interaction.

PTM databases

iPTMnetiQ8NCT3.
PhosphoSiteiQ8NCT3.

Polymorphism and mutation databases

BioMutaiKIAA0895.
DMDMi172045806.

Proteomic databases

EPDiQ8NCT3.
MaxQBiQ8NCT3.
PaxDbiQ8NCT3.
PRIDEiQ8NCT3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000297063; ENSP00000297063; ENSG00000164542. [Q8NCT3-1]
ENST00000317020; ENSP00000319251; ENSG00000164542. [Q8NCT3-3]
ENST00000338533; ENSP00000344805; ENSG00000164542. [Q8NCT3-2]
ENST00000415803; ENSP00000400749; ENSG00000164542. [Q8NCT3-4]
ENST00000436884; ENSP00000389985; ENSG00000164542. [Q8NCT3-5]
ENST00000440378; ENSP00000390837; ENSG00000164542. [Q8NCT3-6]
GeneIDi23366.
KEGGihsa:23366.
UCSCiuc003tfb.3. human. [Q8NCT3-1]

Organism-specific databases

CTDi23366.
GeneCardsiKIAA0895.
HGNCiHGNC:22206. KIAA0895.
HPAiHPA020512.
HPA021036.
neXtProtiNX_Q8NCT3.
PharmGKBiPA164721801.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGSS. Eukaryota.
ENOG410YKC2. LUCA.
GeneTreeiENSGT00390000004417.
HOGENOMiHOG000069902.
HOVERGENiHBG067127.
InParanoidiQ8NCT3.
OMAiMKEGCLG.
PhylomeDBiQ8NCT3.
TreeFamiTF329621.

Miscellaneous databases

ChiTaRSiKIAA0895. human.
GeneWikiiKIAA0895.
GenomeRNAii23366.
PROiQ8NCT3.

Gene expression databases

BgeeiQ8NCT3.
ExpressionAtlasiQ8NCT3. baseline and differential.
GenevisibleiQ8NCT3. HS.

Family and domain databases

InterProiIPR012548. DUF1704.
[Graphical view]
PfamiPF08014. DUF1704. 1 hit.
[Graphical view]
SMARTiSM01154. DUF1704. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:355-364(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Cerebellum.
  3. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 4 AND 6).
    Tissue: Testis.

Entry informationi

Entry nameiK0895_HUMAN
AccessioniPrimary (citable) accession number: Q8NCT3
Secondary accession number(s): B4DF35
, B7ZLT4, B9EGB9, O94969, Q0VGC1, Q7Z4L2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: June 8, 2016
This is version 90 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.