Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NCQ7 (PRCA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 91. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Protein PROCA1
Gene names
Name:PROCA1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length364 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Sequence similarities

Belongs to the PROCA1 family.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processlipid catabolic process

Inferred from electronic annotation. Source: InterPro

   Molecular_functioncalcium ion binding

Inferred from electronic annotation. Source: InterPro

phospholipase A2 activity

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8NCQ7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: Q8NCQ7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     28-58: LSDVNRLPSWERGHLLAGVASSTDVSTFSEG → RCR
Isoform 3 (identifier: Q8NCQ7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MWVRTTLTIERWTKEKTEPKARSWDESLSD → MSITY
     58-58: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 364364Protein PROCA1
PRO_0000336063

Regions

Compositional bias174 – 1829Poly-Glu
Compositional bias226 – 27247Lys-rich

Natural variations

Alternative sequence1 – 3030MWVRT…ESLSD → MSITY in isoform 3.
VSP_053931
Alternative sequence28 – 5831LSDVN…TFSEG → RCR in isoform 2.
VSP_033988
Alternative sequence581Missing in isoform 3.
VSP_053932
Natural variant2451D → A.
Corresponds to variant rs1077127 [ dbSNP | Ensembl ].
VAR_043476
Natural variant3201E → K.
Corresponds to variant rs3744637 [ dbSNP | Ensembl ].
VAR_043477

Experimental info

Sequence conflict891H → Y in BAG63307. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 20, 2008. Version 2.
Checksum: 4646EE99BDAB724F

FASTA36440,522
        10         20         30         40         50         60 
MWVRTTLTIE RWTKEKTEPK ARSWDESLSD VNRLPSWERG HLLAGVASST DVSTFSEGGD 

        70         80         90        100        110        120 
CKEPDKCCWR HKQCTGHIIY PFASDCVRHS LHLHSVNHCN CNSRLKDSSE DSSSSRGAGP 

       130        140        150        160        170        180 
TCSHVIESPC FELTPEEEHV ERFRYGWCKS YRPVSVAVIH HPLYHECGAD DLNEEEEEEE 

       190        200        210        220        230        240 
EESKPPIPTQ VGPATASPDL GTSMATGTPD STAPITIWRS ESPTGKGQGS KVIKKVKKKK 

       250        260        270        280        290        300 
EKEKDKEEMD EKAKLKKKAK KGQLTKKKSP VKLEPSPPDV SRSLSARQLA RMSESSPESR 

       310        320        330        340        350        360 
EELESEDSYN GRGQGELSSE DIVESSSPRK RENTVQAKKT GAKPSQARKV NKRKSPPGSN 


PNLS 

« Hide

Isoform 2 [UniParc].

Checksum: FD51D95493576F71
Show »

FASTA33637,667
Isoform 3 [UniParc].

Checksum: 2FA2FDEA417FF004
Show »

FASTA33837,398

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Testis.
[2]"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. expand/collapse author list , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK301868 mRNA. Translation: BAG63307.1.
AC010761 Genomic DNA. No translation available.
CH471159 Genomic DNA. Translation: EAW51125.1.
CH471159 Genomic DNA. Translation: EAW51126.1.
BC029574 mRNA. Translation: AAH29574.1.
CCDSCCDS11239.1. [Q8NCQ7-2]
RefSeqNP_689678.1. NM_152465.1. [Q8NCQ7-2]
XP_005257989.1. XM_005257932.1. [Q8NCQ7-3]
UniGeneHs.207471.

3D structure databases

ProteinModelPortalQ8NCQ7.
SMRQ8NCQ7. Positions 39-154.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid127029. 1 interaction.
STRING9606.ENSP00000301039.

PTM databases

PhosphoSiteQ8NCQ7.

Polymorphism databases

DMDM189037421.

Proteomic databases

PaxDbQ8NCQ7.
PRIDEQ8NCQ7.

Protocols and materials databases

DNASU147011.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000301039; ENSP00000301039; ENSG00000167525. [Q8NCQ7-2]
ENST00000439862; ENSP00000411400; ENSG00000167525.
GeneID147011.
KEGGhsa:147011.
UCSCuc002hca.1. human. [Q8NCQ7-2]
uc010crv.2. human. [Q8NCQ7-1]

Organism-specific databases

CTD147011.
GeneCardsGC17M027030.
HGNCHGNC:28600. PROCA1.
HPAHPA023648.
HPA030218.
neXtProtNX_Q8NCQ7.
PharmGKBPA165432492.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG47838.
HOGENOMHOG000038028.
HOVERGENHBG108287.
InParanoidQ8NCQ7.
OMACGADDLN.
PhylomeDBQ8NCQ7.
TreeFamTF350402.

Enzyme and pathway databases

SignaLinkQ8NCQ7.

Gene expression databases

ArrayExpressQ8NCQ7.
BgeeQ8NCQ7.
GenevestigatorQ8NCQ7.

Family and domain databases

Gene3D1.20.90.10. 1 hit.
InterProIPR001211. PLipase_A2.
IPR016090. PLipase_A2_dom.
[Graphical view]
PfamPF05826. Phospholip_A2_2. 1 hit.
[Graphical view]
SUPFAMSSF48619. SSF48619. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi147011.
NextBio35475923.
PROQ8NCQ7.

Entry information

Entry namePRCA1_HUMAN
AccessionPrimary (citable) accession number: Q8NCQ7
Secondary accession number(s): B4DX95, G5E9R8
Entry history
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: July 9, 2014
This is version 91 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM