Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NCQ7

- PRCA1_HUMAN

UniProt

Q8NCQ7 - PRCA1_HUMAN

Protein

Protein PROCA1

Gene

PROCA1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 93 (01 Oct 2014)
      Sequence version 2 (20 May 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. phospholipase A2 activity Source: InterPro

    GO - Biological processi

    1. lipid catabolic process Source: InterPro

    Enzyme and pathway databases

    SignaLinkiQ8NCQ7.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein PROCA1
    Gene namesi
    Name:PROCA1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:28600. PROCA1.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA165432492.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 364364Protein PROCA1PRO_0000336063Add
    BLAST

    Proteomic databases

    PaxDbiQ8NCQ7.
    PRIDEiQ8NCQ7.

    PTM databases

    PhosphoSiteiQ8NCQ7.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8NCQ7.
    BgeeiQ8NCQ7.
    GenevestigatoriQ8NCQ7.

    Organism-specific databases

    HPAiHPA023648.
    HPA030218.

    Interactioni

    Protein-protein interaction databases

    BioGridi127029. 1 interaction.
    STRINGi9606.ENSP00000301039.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NCQ7.
    SMRiQ8NCQ7. Positions 39-154.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi174 – 1829Poly-Glu
    Compositional biasi226 – 27247Lys-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the PROCA1 family.Curated

    Phylogenomic databases

    eggNOGiNOG47838.
    HOGENOMiHOG000038028.
    HOVERGENiHBG108287.
    InParanoidiQ8NCQ7.
    OMAiCGADDLN.
    PhylomeDBiQ8NCQ7.
    TreeFamiTF350402.

    Family and domain databases

    Gene3Di1.20.90.10. 1 hit.
    InterProiIPR001211. PLipase_A2.
    IPR016090. PLipase_A2_dom.
    [Graphical view]
    PfamiPF05826. Phospholip_A2_2. 1 hit.
    [Graphical view]
    SUPFAMiSSF48619. SSF48619. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NCQ7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MWVRTTLTIE RWTKEKTEPK ARSWDESLSD VNRLPSWERG HLLAGVASST    50
    DVSTFSEGGD CKEPDKCCWR HKQCTGHIIY PFASDCVRHS LHLHSVNHCN 100
    CNSRLKDSSE DSSSSRGAGP TCSHVIESPC FELTPEEEHV ERFRYGWCKS 150
    YRPVSVAVIH HPLYHECGAD DLNEEEEEEE EESKPPIPTQ VGPATASPDL 200
    GTSMATGTPD STAPITIWRS ESPTGKGQGS KVIKKVKKKK EKEKDKEEMD 250
    EKAKLKKKAK KGQLTKKKSP VKLEPSPPDV SRSLSARQLA RMSESSPESR 300
    EELESEDSYN GRGQGELSSE DIVESSSPRK RENTVQAKKT GAKPSQARKV 350
    NKRKSPPGSN PNLS 364

    Note: No experimental confirmation available.

    Length:364
    Mass (Da):40,522
    Last modified:May 20, 2008 - v2
    Checksum:i4646EE99BDAB724F
    GO
    Isoform 2 (identifier: Q8NCQ7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         28-58: LSDVNRLPSWERGHLLAGVASSTDVSTFSEG → RCR

    Show »
    Length:336
    Mass (Da):37,667
    Checksum:iFD51D95493576F71
    GO
    Isoform 3 (identifier: Q8NCQ7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-30: MWVRTTLTIERWTKEKTEPKARSWDESLSD → MSITY
         58-58: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:338
    Mass (Da):37,398
    Checksum:i2FA2FDEA417FF004
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti89 – 891H → Y in BAG63307. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti245 – 2451D → A.
    Corresponds to variant rs1077127 [ dbSNP | Ensembl ].
    VAR_043476
    Natural varianti320 – 3201E → K.
    Corresponds to variant rs3744637 [ dbSNP | Ensembl ].
    VAR_043477

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3030MWVRT…ESLSD → MSITY in isoform 3. 1 PublicationVSP_053931Add
    BLAST
    Alternative sequencei28 – 5831LSDVN…TFSEG → RCR in isoform 2. 1 PublicationVSP_033988Add
    BLAST
    Alternative sequencei58 – 581Missing in isoform 3. 1 PublicationVSP_053932

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK301868 mRNA. Translation: BAG63307.1.
    AC010761 Genomic DNA. No translation available.
    CH471159 Genomic DNA. Translation: EAW51125.1.
    CH471159 Genomic DNA. Translation: EAW51126.1.
    BC029574 mRNA. Translation: AAH29574.1.
    CCDSiCCDS11239.1. [Q8NCQ7-2]
    RefSeqiNP_689678.1. NM_152465.1. [Q8NCQ7-2]
    XP_005257989.1. XM_005257932.1. [Q8NCQ7-3]
    UniGeneiHs.207471.

    Genome annotation databases

    EnsembliENST00000301039; ENSP00000301039; ENSG00000167525. [Q8NCQ7-2]
    ENST00000439862; ENSP00000411400; ENSG00000167525. [Q8NCQ7-3]
    GeneIDi147011.
    KEGGihsa:147011.
    UCSCiuc002hca.1. human. [Q8NCQ7-2]
    uc002hcb.3. human.
    uc010crv.2. human. [Q8NCQ7-1]

    Polymorphism databases

    DMDMi189037421.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK301868 mRNA. Translation: BAG63307.1 .
    AC010761 Genomic DNA. No translation available.
    CH471159 Genomic DNA. Translation: EAW51125.1 .
    CH471159 Genomic DNA. Translation: EAW51126.1 .
    BC029574 mRNA. Translation: AAH29574.1 .
    CCDSi CCDS11239.1. [Q8NCQ7-2 ]
    RefSeqi NP_689678.1. NM_152465.1. [Q8NCQ7-2 ]
    XP_005257989.1. XM_005257932.1. [Q8NCQ7-3 ]
    UniGenei Hs.207471.

    3D structure databases

    ProteinModelPortali Q8NCQ7.
    SMRi Q8NCQ7. Positions 39-154.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127029. 1 interaction.
    STRINGi 9606.ENSP00000301039.

    PTM databases

    PhosphoSitei Q8NCQ7.

    Polymorphism databases

    DMDMi 189037421.

    Proteomic databases

    PaxDbi Q8NCQ7.
    PRIDEi Q8NCQ7.

    Protocols and materials databases

    DNASUi 147011.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000301039 ; ENSP00000301039 ; ENSG00000167525 . [Q8NCQ7-2 ]
    ENST00000439862 ; ENSP00000411400 ; ENSG00000167525 . [Q8NCQ7-3 ]
    GeneIDi 147011.
    KEGGi hsa:147011.
    UCSCi uc002hca.1. human. [Q8NCQ7-2 ]
    uc002hcb.3. human.
    uc010crv.2. human. [Q8NCQ7-1 ]

    Organism-specific databases

    CTDi 147011.
    GeneCardsi GC17M027030.
    HGNCi HGNC:28600. PROCA1.
    HPAi HPA023648.
    HPA030218.
    neXtProti NX_Q8NCQ7.
    PharmGKBi PA165432492.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG47838.
    HOGENOMi HOG000038028.
    HOVERGENi HBG108287.
    InParanoidi Q8NCQ7.
    OMAi CGADDLN.
    PhylomeDBi Q8NCQ7.
    TreeFami TF350402.

    Enzyme and pathway databases

    SignaLinki Q8NCQ7.

    Miscellaneous databases

    GenomeRNAii 147011.
    NextBioi 35475923.
    PROi Q8NCQ7.

    Gene expression databases

    ArrayExpressi Q8NCQ7.
    Bgeei Q8NCQ7.
    Genevestigatori Q8NCQ7.

    Family and domain databases

    Gene3Di 1.20.90.10. 1 hit.
    InterProi IPR001211. PLipase_A2.
    IPR016090. PLipase_A2_dom.
    [Graphical view ]
    Pfami PF05826. Phospholip_A2_2. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48619. SSF48619. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Testis.
    2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.

    Entry informationi

    Entry nameiPRCA1_HUMAN
    AccessioniPrimary (citable) accession number: Q8NCQ7
    Secondary accession number(s): B4DX95, G5E9R8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 20, 2008
    Last sequence update: May 20, 2008
    Last modified: October 1, 2014
    This is version 93 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3