Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein PROCA1

Gene

PROCA1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000167525-MONOMER.
SignaLinkiQ8NCQ7.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein PROCA1
Gene namesi
Name:PROCA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:28600. PROCA1.

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000167525.
PharmGKBiPA165432492.

Polymorphism and mutation databases

BioMutaiPROCA1.
DMDMi189037421.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003360631 – 364Protein PROCA1Add BLAST364

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei276PhosphoserineBy similarity1
Modified residuei308PhosphoserineBy similarity1
Modified residuei318PhosphoserineBy similarity1
Modified residuei319PhosphoserineBy similarity1
Modified residuei355PhosphoserineBy similarity1
Modified residuei364PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRIDEiQ8NCQ7.

PTM databases

iPTMnetiQ8NCQ7.
PhosphoSitePlusiQ8NCQ7.

Expressioni

Gene expression databases

BgeeiENSG00000167525.
ExpressionAtlasiQ8NCQ7. baseline and differential.
GenevisibleiQ8NCQ7. HS.

Organism-specific databases

HPAiHPA023648.
HPA030218.

Interactioni

Protein-protein interaction databases

BioGridi127029. 1 interactor.

Structurei

3D structure databases

ProteinModelPortaliQ8NCQ7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi174 – 182Poly-Glu9
Compositional biasi226 – 272Lys-richAdd BLAST47

Sequence similaritiesi

Belongs to the PROCA1 family.Curated

Phylogenomic databases

GeneTreeiENSGT00530000063569.
HOGENOMiHOG000038028.
HOVERGENiHBG108287.
InParanoidiQ8NCQ7.
PhylomeDBiQ8NCQ7.
TreeFamiTF350402.

Family and domain databases

Gene3Di1.20.90.10. 1 hit.
InterProiIPR016090. PLipase_A2_dom.
[Graphical view]
PfamiPF05826. Phospholip_A2_2. 1 hit.
[Graphical view]
SUPFAMiSSF48619. SSF48619. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NCQ7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWVRTTLTIE RWTKEKTEPK ARSWDESLSD VNRLPSWERG HLLAGVASST
60 70 80 90 100
DVSTFSEGGD CKEPDKCCWR HKQCTGHIIY PFASDCVRHS LHLHSVNHCN
110 120 130 140 150
CNSRLKDSSE DSSSSRGAGP TCSHVIESPC FELTPEEEHV ERFRYGWCKS
160 170 180 190 200
YRPVSVAVIH HPLYHECGAD DLNEEEEEEE EESKPPIPTQ VGPATASPDL
210 220 230 240 250
GTSMATGTPD STAPITIWRS ESPTGKGQGS KVIKKVKKKK EKEKDKEEMD
260 270 280 290 300
EKAKLKKKAK KGQLTKKKSP VKLEPSPPDV SRSLSARQLA RMSESSPESR
310 320 330 340 350
EELESEDSYN GRGQGELSSE DIVESSSPRK RENTVQAKKT GAKPSQARKV
360
NKRKSPPGSN PNLS
Note: No experimental confirmation available.
Length:364
Mass (Da):40,522
Last modified:May 20, 2008 - v2
Checksum:i4646EE99BDAB724F
GO
Isoform 2 (identifier: Q8NCQ7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-58: LSDVNRLPSWERGHLLAGVASSTDVSTFSEG → RCR

Show »
Length:336
Mass (Da):37,667
Checksum:iFD51D95493576F71
GO
Isoform 3 (identifier: Q8NCQ7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MWVRTTLTIERWTKEKTEPKARSWDESLSD → MSITY
     58-58: Missing.

Note: No experimental confirmation available.
Show »
Length:338
Mass (Da):37,398
Checksum:i2FA2FDEA417FF004
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti89H → Y in BAG63307 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_043476245D → A.Corresponds to variant rs1077127dbSNPEnsembl.1
Natural variantiVAR_043477320E → K.Corresponds to variant rs3744637dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0539311 – 30MWVRT…ESLSD → MSITY in isoform 3. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_03398828 – 58LSDVN…TFSEG → RCR in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_05393258Missing in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK301868 mRNA. Translation: BAG63307.1.
AC010761 Genomic DNA. No translation available.
CH471159 Genomic DNA. Translation: EAW51125.1.
CH471159 Genomic DNA. Translation: EAW51126.1.
BC029574 mRNA. Translation: AAH29574.1.
CCDSiCCDS11239.1. [Q8NCQ7-2]
RefSeqiNP_001291878.1. NM_001304949.1.
NP_001291880.1. NM_001304951.1.
NP_001291881.1. NM_001304952.1. [Q8NCQ7-3]
NP_001291882.1. NM_001304953.1.
NP_001291883.1. NM_001304954.1.
NP_689678.1. NM_152465.2. [Q8NCQ7-2]
UniGeneiHs.207471.

Genome annotation databases

EnsembliENST00000301039; ENSP00000301039; ENSG00000167525. [Q8NCQ7-2]
GeneIDi147011.
KEGGihsa:147011.
UCSCiuc002hca.2. human. [Q8NCQ7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK301868 mRNA. Translation: BAG63307.1.
AC010761 Genomic DNA. No translation available.
CH471159 Genomic DNA. Translation: EAW51125.1.
CH471159 Genomic DNA. Translation: EAW51126.1.
BC029574 mRNA. Translation: AAH29574.1.
CCDSiCCDS11239.1. [Q8NCQ7-2]
RefSeqiNP_001291878.1. NM_001304949.1.
NP_001291880.1. NM_001304951.1.
NP_001291881.1. NM_001304952.1. [Q8NCQ7-3]
NP_001291882.1. NM_001304953.1.
NP_001291883.1. NM_001304954.1.
NP_689678.1. NM_152465.2. [Q8NCQ7-2]
UniGeneiHs.207471.

3D structure databases

ProteinModelPortaliQ8NCQ7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127029. 1 interactor.

PTM databases

iPTMnetiQ8NCQ7.
PhosphoSitePlusiQ8NCQ7.

Polymorphism and mutation databases

BioMutaiPROCA1.
DMDMi189037421.

Proteomic databases

PRIDEiQ8NCQ7.

Protocols and materials databases

DNASUi147011.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301039; ENSP00000301039; ENSG00000167525. [Q8NCQ7-2]
GeneIDi147011.
KEGGihsa:147011.
UCSCiuc002hca.2. human. [Q8NCQ7-1]

Organism-specific databases

CTDi147011.
GeneCardsiPROCA1.
HGNCiHGNC:28600. PROCA1.
HPAiHPA023648.
HPA030218.
neXtProtiNX_Q8NCQ7.
OpenTargetsiENSG00000167525.
PharmGKBiPA165432492.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00530000063569.
HOGENOMiHOG000038028.
HOVERGENiHBG108287.
InParanoidiQ8NCQ7.
PhylomeDBiQ8NCQ7.
TreeFamiTF350402.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000167525-MONOMER.
SignaLinkiQ8NCQ7.

Miscellaneous databases

GenomeRNAii147011.
PROiQ8NCQ7.

Gene expression databases

BgeeiENSG00000167525.
ExpressionAtlasiQ8NCQ7. baseline and differential.
GenevisibleiQ8NCQ7. HS.

Family and domain databases

Gene3Di1.20.90.10. 1 hit.
InterProiIPR016090. PLipase_A2_dom.
[Graphical view]
PfamiPF05826. Phospholip_A2_2. 1 hit.
[Graphical view]
SUPFAMiSSF48619. SSF48619. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiPRCA1_HUMAN
AccessioniPrimary (citable) accession number: Q8NCQ7
Secondary accession number(s): B4DX95, G5E9R8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: November 2, 2016
This is version 109 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.