Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NCQ7

- PRCA1_HUMAN

UniProt

Q8NCQ7 - PRCA1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein PROCA1

Gene

PROCA1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 2 out of 5- Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. phospholipase A2 activity Source: InterPro

GO - Biological processi

  1. lipid catabolic process Source: InterPro
Complete GO annotation...

Enzyme and pathway databases

SignaLinkiQ8NCQ7.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein PROCA1
Gene namesi
Name:PROCA1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:28600. PROCA1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA165432492.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 364364Protein PROCA1PRO_0000336063Add
BLAST

Proteomic databases

PaxDbiQ8NCQ7.
PRIDEiQ8NCQ7.

PTM databases

PhosphoSiteiQ8NCQ7.

Expressioni

Gene expression databases

BgeeiQ8NCQ7.
ExpressionAtlasiQ8NCQ7. baseline and differential.
GenevestigatoriQ8NCQ7.

Organism-specific databases

HPAiHPA023648.
HPA030218.

Interactioni

Protein-protein interaction databases

BioGridi127029. 1 interaction.
STRINGi9606.ENSP00000301039.

Structurei

3D structure databases

ProteinModelPortaliQ8NCQ7.
SMRiQ8NCQ7. Positions 39-154.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi174 – 1829Poly-Glu
Compositional biasi226 – 27247Lys-richAdd
BLAST

Sequence similaritiesi

Belongs to the PROCA1 family.Curated

Phylogenomic databases

eggNOGiNOG47838.
GeneTreeiENSGT00530000063569.
HOGENOMiHOG000038028.
HOVERGENiHBG108287.
InParanoidiQ8NCQ7.
OMAiCGADDLN.
PhylomeDBiQ8NCQ7.
TreeFamiTF350402.

Family and domain databases

Gene3Di1.20.90.10. 1 hit.
InterProiIPR001211. PLipase_A2.
IPR016090. PLipase_A2_dom.
[Graphical view]
PfamiPF05826. Phospholip_A2_2. 1 hit.
[Graphical view]
SUPFAMiSSF48619. SSF48619. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8NCQ7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MWVRTTLTIE RWTKEKTEPK ARSWDESLSD VNRLPSWERG HLLAGVASST
60 70 80 90 100
DVSTFSEGGD CKEPDKCCWR HKQCTGHIIY PFASDCVRHS LHLHSVNHCN
110 120 130 140 150
CNSRLKDSSE DSSSSRGAGP TCSHVIESPC FELTPEEEHV ERFRYGWCKS
160 170 180 190 200
YRPVSVAVIH HPLYHECGAD DLNEEEEEEE EESKPPIPTQ VGPATASPDL
210 220 230 240 250
GTSMATGTPD STAPITIWRS ESPTGKGQGS KVIKKVKKKK EKEKDKEEMD
260 270 280 290 300
EKAKLKKKAK KGQLTKKKSP VKLEPSPPDV SRSLSARQLA RMSESSPESR
310 320 330 340 350
EELESEDSYN GRGQGELSSE DIVESSSPRK RENTVQAKKT GAKPSQARKV
360
NKRKSPPGSN PNLS

Note: No experimental confirmation available.

Length:364
Mass (Da):40,522
Last modified:May 20, 2008 - v2
Checksum:i4646EE99BDAB724F
GO
Isoform 2 (identifier: Q8NCQ7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-58: LSDVNRLPSWERGHLLAGVASSTDVSTFSEG → RCR

Show »
Length:336
Mass (Da):37,667
Checksum:iFD51D95493576F71
GO
Isoform 3 (identifier: Q8NCQ7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-30: MWVRTTLTIERWTKEKTEPKARSWDESLSD → MSITY
     58-58: Missing.

Note: No experimental confirmation available.

Show »
Length:338
Mass (Da):37,398
Checksum:i2FA2FDEA417FF004
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti89 – 891H → Y in BAG63307. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti245 – 2451D → A.
Corresponds to variant rs1077127 [ dbSNP | Ensembl ].
VAR_043476
Natural varianti320 – 3201E → K.
Corresponds to variant rs3744637 [ dbSNP | Ensembl ].
VAR_043477

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3030MWVRT…ESLSD → MSITY in isoform 3. 1 PublicationVSP_053931Add
BLAST
Alternative sequencei28 – 5831LSDVN…TFSEG → RCR in isoform 2. 1 PublicationVSP_033988Add
BLAST
Alternative sequencei58 – 581Missing in isoform 3. 1 PublicationVSP_053932

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK301868 mRNA. Translation: BAG63307.1.
AC010761 Genomic DNA. No translation available.
CH471159 Genomic DNA. Translation: EAW51125.1.
CH471159 Genomic DNA. Translation: EAW51126.1.
BC029574 mRNA. Translation: AAH29574.1.
CCDSiCCDS11239.1. [Q8NCQ7-2]
RefSeqiNP_689678.1. NM_152465.1. [Q8NCQ7-2]
XP_005257989.1. XM_005257932.1. [Q8NCQ7-3]
UniGeneiHs.207471.

Genome annotation databases

EnsembliENST00000301039; ENSP00000301039; ENSG00000167525. [Q8NCQ7-2]
GeneIDi147011.
KEGGihsa:147011.
UCSCiuc002hca.1. human. [Q8NCQ7-2]
uc002hcb.3. human.
uc010crv.2. human. [Q8NCQ7-1]

Polymorphism databases

DMDMi189037421.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK301868 mRNA. Translation: BAG63307.1 .
AC010761 Genomic DNA. No translation available.
CH471159 Genomic DNA. Translation: EAW51125.1 .
CH471159 Genomic DNA. Translation: EAW51126.1 .
BC029574 mRNA. Translation: AAH29574.1 .
CCDSi CCDS11239.1. [Q8NCQ7-2 ]
RefSeqi NP_689678.1. NM_152465.1. [Q8NCQ7-2 ]
XP_005257989.1. XM_005257932.1. [Q8NCQ7-3 ]
UniGenei Hs.207471.

3D structure databases

ProteinModelPortali Q8NCQ7.
SMRi Q8NCQ7. Positions 39-154.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127029. 1 interaction.
STRINGi 9606.ENSP00000301039.

PTM databases

PhosphoSitei Q8NCQ7.

Polymorphism databases

DMDMi 189037421.

Proteomic databases

PaxDbi Q8NCQ7.
PRIDEi Q8NCQ7.

Protocols and materials databases

DNASUi 147011.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000301039 ; ENSP00000301039 ; ENSG00000167525 . [Q8NCQ7-2 ]
GeneIDi 147011.
KEGGi hsa:147011.
UCSCi uc002hca.1. human. [Q8NCQ7-2 ]
uc002hcb.3. human.
uc010crv.2. human. [Q8NCQ7-1 ]

Organism-specific databases

CTDi 147011.
GeneCardsi GC17M027030.
HGNCi HGNC:28600. PROCA1.
HPAi HPA023648.
HPA030218.
neXtProti NX_Q8NCQ7.
PharmGKBi PA165432492.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG47838.
GeneTreei ENSGT00530000063569.
HOGENOMi HOG000038028.
HOVERGENi HBG108287.
InParanoidi Q8NCQ7.
OMAi CGADDLN.
PhylomeDBi Q8NCQ7.
TreeFami TF350402.

Enzyme and pathway databases

SignaLinki Q8NCQ7.

Miscellaneous databases

GenomeRNAii 147011.
NextBioi 35475923.
PROi Q8NCQ7.

Gene expression databases

Bgeei Q8NCQ7.
ExpressionAtlasi Q8NCQ7. baseline and differential.
Genevestigatori Q8NCQ7.

Family and domain databases

Gene3Di 1.20.90.10. 1 hit.
InterProi IPR001211. PLipase_A2.
IPR016090. PLipase_A2_dom.
[Graphical view ]
Pfami PF05826. Phospholip_A2_2. 1 hit.
[Graphical view ]
SUPFAMi SSF48619. SSF48619. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiPRCA1_HUMAN
AccessioniPrimary (citable) accession number: Q8NCQ7
Secondary accession number(s): B4DX95, G5E9R8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: October 29, 2014
This is version 94 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3