Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NCE0

- SEN2_HUMAN

UniProt

Q8NCE0 - SEN2_HUMAN

Protein

tRNA-splicing endonuclease subunit Sen2

Gene

TSEN2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 102 (01 Oct 2014)
      Sequence version 2 (19 Jul 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Constitutes one of the two catalytic subunit of the tRNA-splicing endonuclease complex, a complex responsible for identification and cleavage of the splice sites in pre-tRNA. It cleaves pre-tRNA at the 5'- and 3'-splice sites to release the intron. The products are an intron and two tRNA half-molecules bearing 2',3'-cyclic phosphate and 5'-OH termini. There are no conserved sequences at the splice sites, but the intron is invariably located at the same site in the gene, placing the splice sites an invariant distance from the constant structural features of the tRNA body. Isoform 1 probably carries the active site for 5'-splice site cleavage. The tRNA splicing endonuclease is also involved in mRNA processing via its association with pre-mRNA 3'-end processing factors, establishing a link between pre-tRNA splicing and pre-mRNA 3'-end formation, suggesting that the endonuclease subunits function in multiple RNA-processing events. Isoform 2 is responsible for processing a yet unknown RNA substrate. The complex containing isoform 2 is not able to cleave pre-tRNAs properly, although it retains endonucleolytic activity.1 Publication

    Catalytic activityi

    PretRNA = a 3'-half-tRNA molecule with a 5'-OH end + a 5'-half-tRNA molecule with a 2',3'-cyclic phosphate end + an intron with a 2',3'-cyclic phosphate and a 5'-hydroxyl terminus.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei369 – 3691By similarity
    Active sitei377 – 3771By similarity
    Active sitei416 – 4161By similarity

    GO - Molecular functioni

    1. lyase activity Source: UniProtKB-KW
    2. nucleic acid binding Source: InterPro
    3. tRNA-intron endonuclease activity Source: InterPro

    GO - Biological processi

    1. mRNA processing Source: UniProtKB-KW
    2. tRNA splicing, via endonucleolytic cleavage and ligation Source: UniProtKB

    Keywords - Molecular functioni

    Lyase

    Keywords - Biological processi

    mRNA processing, tRNA processing

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    tRNA-splicing endonuclease subunit Sen2 (EC:4.6.1.16)
    Alternative name(s):
    tRNA-intron endonuclease Sen2
    Short name:
    HsSen2
    Gene namesi
    Name:TSEN2
    Synonyms:SEN2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:28422. TSEN2.

    Subcellular locationi

    Nucleus 1 Publication. Nucleusnucleolus 1 Publication
    Note: May be transiently localized in the nucleolus.

    GO - Cellular componenti

    1. centrosome Source: HPA
    2. cytoplasm Source: HPA
    3. nucleus Source: HPA
    4. tRNA-intron endonuclease complex Source: InterPro

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    Pontocerebellar hypoplasia 2B (PCH2B) [MIM:612389]: A disorder characterized by an abnormally small cerebellum and brainstem, and progressive microcephaly from birth combined with extrapyramidal dyskinesia. Severe chorea occurs and epilepsy is frequent. There are no signs of spinal cord anterior horn cells degeneration.1 Publication
    Note: The disease is caused by mutations affecting the gene represented in this entry.
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti309 – 3091Y → C in PCH2B. 1 Publication
    Corresponds to variant rs113994149 [ dbSNP | Ensembl ].
    VAR_054810

    Keywords - Diseasei

    Pontocerebellar hypoplasia

    Organism-specific databases

    MIMi612389. phenotype.
    Orphaneti2524. Pontocerebellar hypoplasia type 2.
    PharmGKBiPA142670695.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 465465tRNA-splicing endonuclease subunit Sen2PRO_0000109452Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei408 – 4081PhosphoserineBy similarity
    Modified residuei411 – 4111PhosphoserineBy similarity
    Modified residuei415 – 4151PhosphoserineBy similarity

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8NCE0.
    PaxDbiQ8NCE0.
    PRIDEiQ8NCE0.

    PTM databases

    PhosphoSiteiQ8NCE0.

    Expressioni

    Tissue specificityi

    Isoform 1 and isoform 2 are widely expressed at very low level.1 Publication

    Gene expression databases

    ArrayExpressiQ8NCE0.
    BgeeiQ8NCE0.
    CleanExiHS_TSEN2.
    GenevestigatoriQ8NCE0.

    Organism-specific databases

    HPAiHPA027120.
    HPA027125.
    HPA027268.

    Interactioni

    Subunit structurei

    tRNA splicing endonuclease is a heterotetramer composed of isoform 1 of SEN2, SEN15, SEN34/LENG5 and SEN54. tRNA splicing endonuclease complex also contains proteins of the pre-mRNA 3'-end processing machinery such as CLP1, CPSF1, CPSF4 and CSTF2. Isoform 2 belongs to a different complex that contains SEN54 but low level of SEN15 and SEN34/LENG5.

    Protein-protein interaction databases

    BioGridi123288. 14 interactions.
    IntActiQ8NCE0. 1 interaction.
    STRINGi9606.ENSP00000284995.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NCE0.
    SMRiQ8NCE0. Positions 279-420.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the tRNA-intron endonuclease family.Curated

    Phylogenomic databases

    eggNOGiCOG1676.
    HOGENOMiHOG000154285.
    HOVERGENiHBG056610.
    InParanoidiQ8NCE0.
    KOiK15322.
    OMAiTESKEVQ.
    PhylomeDBiQ8NCE0.
    TreeFamiTF314679.

    Family and domain databases

    Gene3Di3.40.1350.10. 1 hit.
    InterProiIPR011856. tRNA_endonuc-like_dom.
    IPR006677. tRNA_intron_Endonuc_cat-like.
    IPR006678. tRNA_intron_Endonuc_N.
    IPR016589. tRNA_splic_SEN2.
    [Graphical view]
    PfamiPF01974. tRNA_int_endo. 1 hit.
    PF02778. tRNA_int_endo_N. 1 hit.
    [Graphical view]
    PIRSFiPIRSF011789. tRNA_splic_SEN2. 1 hit.
    SUPFAMiSSF53032. SSF53032. 1 hit.

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NCE0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAEAVFHAPK RKRRVYETYE SPLPIPFGQD HGPLKEFKIF RAEMINNNVI    50
    VRNAEDIEQL YGKGYFGKGI LSRSRPSFTI SDPKLVAKWK DMKTNMPIIT 100
    SKRYQHSVEW AAELMRRQGQ DESTVRRILK DYTKPLEHPP VKRNEEAQVH 150
    DKLNSGMVSN MEGTAGGERP SVVNGDSGKS GGVGDPREPL GCLQEGSGCH 200
    PTTESFEKSV REDASPLPHV CCCKQDALIL QRGLHHEDGS QHIGLLHPGD 250
    RGPDHEYVLV EEAECAMSER EAAPNEELVQ RNRLICRRNP YRIFEYLQLS 300
    LEEAFFLVYA LGCLSIYYEK EPLTIVKLWK AFTVVQPTFR TTYMAYHYFR 350
    SKGWVPKVGL KYGTDLLLYR KGPPFYHASY SVIIELVDDH FEGSLRRPLS 400
    WKSLAALSRV SVNVSKELML CYLIKPSTMT DKEMESPECM KRIKVQEVIL 450
    SRWVSSRERS DQDDL 465
    Length:465
    Mass (Da):53,247
    Last modified:July 19, 2004 - v2
    Checksum:iFF523229B05A1345
    GO
    Isoform 2 (identifier: Q8NCE0-2) [UniParc]FASTAAdd to Basket

    Also known as: SEN2deltaEx8, DeltaEx8

    The sequence of this isoform differs from the canonical sequence as follows:
         304-320: Missing.

    Show »
    Length:448
    Mass (Da):51,265
    Checksum:iB616BDFCDA590E32
    GO
    Isoform 3 (identifier: Q8NCE0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         278-303: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:439
    Mass (Da):49,942
    Checksum:i97A9E847199BDE08
    GO
    Isoform 4 (identifier: Q8NCE0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         173-231: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:406
    Mass (Da):47,124
    Checksum:i61FD06EBE21EEEFD
    GO
    Isoform 5 (identifier: Q8NCE0-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         276-301: Missing.
         417-465: ELMLCYLIKPSTMTDKEMESPECMKRIKVQEVILSRWVSSRERSDQDDL → VTQHQLCHWSVT

    Note: No experimental confirmation available.

    Show »
    Length:402
    Mass (Da):45,532
    Checksum:i8B231F84B72FA227
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti138 – 1381H → Q in BAH13287. (PubMed:14702039)Curated
    Sequence conflicti208 – 2081K → E in BAH13287. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti41 – 411R → H.
    Corresponds to variant rs12495784 [ dbSNP | Ensembl ].
    VAR_048931
    Natural varianti126 – 1261R → H.
    Corresponds to variant rs33955793 [ dbSNP | Ensembl ].
    VAR_048932
    Natural varianti309 – 3091Y → C in PCH2B. 1 Publication
    Corresponds to variant rs113994149 [ dbSNP | Ensembl ].
    VAR_054810

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei173 – 23159Missing in isoform 4. 1 PublicationVSP_046192Add
    BLAST
    Alternative sequencei276 – 30126Missing in isoform 5. 1 PublicationVSP_046193Add
    BLAST
    Alternative sequencei278 – 30326Missing in isoform 3. 1 PublicationVSP_010985Add
    BLAST
    Alternative sequencei304 – 32017Missing in isoform 2. 1 PublicationVSP_010986Add
    BLAST
    Alternative sequencei417 – 46549ELMLC…DQDDL → VTQHQLCHWSVT in isoform 5. 1 PublicationVSP_046194Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK074794 mRNA. Translation: BAC11213.1.
    AK300449 mRNA. Translation: BAH13287.1.
    AK225875 mRNA. No translation available.
    AC018500 Genomic DNA. No translation available.
    AC090947 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64129.1.
    BC004178 mRNA. Translation: AAH04178.1.
    BC004211 mRNA. Translation: AAH04211.1.
    BC019582 mRNA. Translation: AAH19582.1.
    BC021975 mRNA. Translation: AAH21975.2.
    CCDSiCCDS2611.1. [Q8NCE0-1]
    CCDS46757.1. [Q8NCE0-3]
    CCDS46758.1. [Q8NCE0-4]
    CCDS46759.1. [Q8NCE0-5]
    RefSeqiNP_001138864.1. NM_001145392.1. [Q8NCE0-1]
    NP_001138865.1. NM_001145393.1. [Q8NCE0-3]
    NP_001138866.1. NM_001145394.1. [Q8NCE0-4]
    NP_001138867.1. NM_001145395.1. [Q8NCE0-5]
    NP_079541.1. NM_025265.3. [Q8NCE0-1]
    XP_005265552.1. XM_005265495.1. [Q8NCE0-1]
    XP_005265554.1. XM_005265497.1. [Q8NCE0-3]
    UniGeneiHs.335550.

    Genome annotation databases

    EnsembliENST00000284995; ENSP00000284995; ENSG00000154743. [Q8NCE0-1]
    ENST00000402228; ENSP00000385976; ENSG00000154743. [Q8NCE0-1]
    ENST00000415684; ENSP00000416510; ENSG00000154743. [Q8NCE0-3]
    ENST00000444864; ENSP00000407974; ENSG00000154743. [Q8NCE0-5]
    ENST00000454502; ENSP00000392029; ENSG00000154743. [Q8NCE0-4]
    GeneIDi80746.
    KEGGihsa:80746.
    UCSCiuc003bxa.3. human. [Q8NCE0-3]
    uc003bxb.3. human. [Q8NCE0-1]
    uc011auq.1. human.

    Polymorphism databases

    DMDMi50428914.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK074794 mRNA. Translation: BAC11213.1 .
    AK300449 mRNA. Translation: BAH13287.1 .
    AK225875 mRNA. No translation available.
    AC018500 Genomic DNA. No translation available.
    AC090947 Genomic DNA. No translation available.
    CH471055 Genomic DNA. Translation: EAW64129.1 .
    BC004178 mRNA. Translation: AAH04178.1 .
    BC004211 mRNA. Translation: AAH04211.1 .
    BC019582 mRNA. Translation: AAH19582.1 .
    BC021975 mRNA. Translation: AAH21975.2 .
    CCDSi CCDS2611.1. [Q8NCE0-1 ]
    CCDS46757.1. [Q8NCE0-3 ]
    CCDS46758.1. [Q8NCE0-4 ]
    CCDS46759.1. [Q8NCE0-5 ]
    RefSeqi NP_001138864.1. NM_001145392.1. [Q8NCE0-1 ]
    NP_001138865.1. NM_001145393.1. [Q8NCE0-3 ]
    NP_001138866.1. NM_001145394.1. [Q8NCE0-4 ]
    NP_001138867.1. NM_001145395.1. [Q8NCE0-5 ]
    NP_079541.1. NM_025265.3. [Q8NCE0-1 ]
    XP_005265552.1. XM_005265495.1. [Q8NCE0-1 ]
    XP_005265554.1. XM_005265497.1. [Q8NCE0-3 ]
    UniGenei Hs.335550.

    3D structure databases

    ProteinModelPortali Q8NCE0.
    SMRi Q8NCE0. Positions 279-420.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123288. 14 interactions.
    IntActi Q8NCE0. 1 interaction.
    STRINGi 9606.ENSP00000284995.

    PTM databases

    PhosphoSitei Q8NCE0.

    Polymorphism databases

    DMDMi 50428914.

    Proteomic databases

    MaxQBi Q8NCE0.
    PaxDbi Q8NCE0.
    PRIDEi Q8NCE0.

    Protocols and materials databases

    DNASUi 80746.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000284995 ; ENSP00000284995 ; ENSG00000154743 . [Q8NCE0-1 ]
    ENST00000402228 ; ENSP00000385976 ; ENSG00000154743 . [Q8NCE0-1 ]
    ENST00000415684 ; ENSP00000416510 ; ENSG00000154743 . [Q8NCE0-3 ]
    ENST00000444864 ; ENSP00000407974 ; ENSG00000154743 . [Q8NCE0-5 ]
    ENST00000454502 ; ENSP00000392029 ; ENSG00000154743 . [Q8NCE0-4 ]
    GeneIDi 80746.
    KEGGi hsa:80746.
    UCSCi uc003bxa.3. human. [Q8NCE0-3 ]
    uc003bxb.3. human. [Q8NCE0-1 ]
    uc011auq.1. human.

    Organism-specific databases

    CTDi 80746.
    GeneCardsi GC03P012525.
    HGNCi HGNC:28422. TSEN2.
    HPAi HPA027120.
    HPA027125.
    HPA027268.
    MIMi 608753. gene.
    612389. phenotype.
    neXtProti NX_Q8NCE0.
    Orphaneti 2524. Pontocerebellar hypoplasia type 2.
    PharmGKBi PA142670695.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1676.
    HOGENOMi HOG000154285.
    HOVERGENi HBG056610.
    InParanoidi Q8NCE0.
    KOi K15322.
    OMAi TESKEVQ.
    PhylomeDBi Q8NCE0.
    TreeFami TF314679.

    Miscellaneous databases

    GeneWikii TSEN2.
    GenomeRNAii 80746.
    NextBioi 71098.
    PROi Q8NCE0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8NCE0.
    Bgeei Q8NCE0.
    CleanExi HS_TSEN2.
    Genevestigatori Q8NCE0.

    Family and domain databases

    Gene3Di 3.40.1350.10. 1 hit.
    InterProi IPR011856. tRNA_endonuc-like_dom.
    IPR006677. tRNA_intron_Endonuc_cat-like.
    IPR006678. tRNA_intron_Endonuc_N.
    IPR016589. tRNA_splic_SEN2.
    [Graphical view ]
    Pfami PF01974. tRNA_int_endo. 1 hit.
    PF02778. tRNA_int_endo_N. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF011789. tRNA_splic_SEN2. 1 hit.
    SUPFAMi SSF53032. SSF53032. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation."
      Paushkin S.V., Patel M., Furia B.S., Peltz S.W., Trotta C.R.
      Cell 117:311-321(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), ALTERNATIVE SPLICING, FUNCTION, SUBCELLULAR LOCATION, COMPONENT OF A COMPLEX WITH SEN15; SEN34; SEN54 AND CLP1, TISSUE SPECIFICITY.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5).
      Tissue: Placenta and Teratocarcinoma.
    3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    4. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon, Eye and Skin.
    7. Cited for: VARIANT PCH2B CYS-309.

    Entry informationi

    Entry nameiSEN2_HUMAN
    AccessioniPrimary (citable) accession number: Q8NCE0
    Secondary accession number(s): B7Z6K1
    , C9IZI7, G5E9Q3, Q8WTW7, Q9BPU7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 19, 2004
    Last sequence update: July 19, 2004
    Last modified: October 1, 2014
    This is version 102 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3