Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NC06

- ACBD4_HUMAN

UniProt

Q8NC06 - ACBD4_HUMAN

Protein

Acyl-CoA-binding domain-containing protein 4

Gene

ACBD4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 95 (01 Oct 2014)
      Sequence version 2 (07 Jun 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Binds medium- and long-chain acyl-CoA esters and may function as an intracellular carrier of acyl-CoA esters.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei69 – 691Acyl-CoA
    Binding sitei88 – 881Acyl-CoA

    GO - Molecular functioni

    1. fatty-acyl-CoA binding Source: InterPro
    2. lipid binding Source: UniProtKB-KW

    Keywords - Ligandi

    Lipid-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Acyl-CoA-binding domain-containing protein 4
    Gene namesi
    Name:ACBD4
    ORF Names:HMFT0700
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:23337. ACBD4.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134897893.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 268268Acyl-CoA-binding domain-containing protein 4PRO_0000214032Add
    BLAST

    Proteomic databases

    MaxQBiQ8NC06.
    PaxDbiQ8NC06.
    PRIDEiQ8NC06.

    PTM databases

    PhosphoSiteiQ8NC06.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8NC06.
    BgeeiQ8NC06.
    CleanExiHS_ACBD4.
    GenevestigatoriQ8NC06.

    Organism-specific databases

    HPAiHPA051772.

    Interactioni

    Protein-protein interaction databases

    BioGridi122878. 1 interaction.
    STRINGi9606.ENSP00000314440.

    Structurei

    Secondary structure

    1
    268
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi14 – 2512
    Helixi36 – 5116
    Helixi64 – 7411
    Turni75 – 784
    Helixi81 – 10020

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2WH5X-ray2.60A/B/C/D/E/F7-110[»]
    ProteinModelPortaliQ8NC06.
    SMRiQ8NC06. Positions 13-102.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ8NC06.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini12 – 10190ACBPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni23 – 3210Acyl-CoA binding
    Regioni43 – 475Acyl-CoA binding

    Sequence similaritiesi

    Contains 1 ACB (acyl-CoA-binding) domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG4281.
    HOGENOMiHOG000231479.
    HOVERGENiHBG028530.
    OMAiIPWSSWS.
    OrthoDBiEOG7TJ3JP.
    PhylomeDBiQ8NC06.
    TreeFamiTF319446.

    Family and domain databases

    Gene3Di1.20.80.10. 1 hit.
    InterProiIPR022408. Acyl-CoA-binding_prot_CS.
    IPR000582. Acyl-CoA-binding_protein.
    IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
    [Graphical view]
    PfamiPF00887. ACBP. 1 hit.
    [Graphical view]
    PRINTSiPR00689. ACOABINDINGP.
    SUPFAMiSSF47027. SSF47027. 1 hit.
    PROSITEiPS00880. ACB_1. 1 hit.
    PS51228. ACB_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NC06-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGTEKESPEP DCQKQFQAAV SVIQNLPKNG SYRPSYEEML RFYSYYKQAT    50
    MGPCLVPRPG FWDPIGRYKW DAWNSLGKMS REEAMSAYIT EMKLVAQKVI 100
    DTVPLGEVAE DMFGYFEPLY QVIPDMPRPP ETFLRRVTGW KEQVVNGDVG 150
    AVSEPPCLPK EPAPPSPESH SPRDLDSEVF CDSLEQLEPE LSSGQHLEES 200
    VIPGTAPCPP QRKRGCGAAR RGPRSWTCGC WGQFEHYRRA CRRCRRGCRA 250
    WRACPGPLSS LTLSVRLE 268
    Length:268
    Mass (Da):30,308
    Last modified:June 7, 2005 - v2
    Checksum:i0F337D89924CDE2E
    GO
    Isoform 2 (identifier: Q8NC06-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         192-268: SSGQHLEESV...SSLTLSVRLE → VWTEQRAASG...LFRMFRTQKR

    Show »
    Length:305
    Mass (Da):34,756
    Checksum:i1EB97FF94E682547
    GO
    Isoform 3 (identifier: Q8NC06-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         168-191: ESHSPRDLDSEVFCDSLEQLEPEL → ASLWAVTLPTPPQSPIHPGTWTPRFSVIPWSSWSLSWFGQ
         260-268: SLTLSVRLE → RGRSPGPVLGHGPLGSRGPRCSSSSCGPSSSSGSSECFGPKRGDCQWRGLCSQLRLSCCALSLPRV

    Show »
    Length:341
    Mass (Da):37,786
    Checksum:iEFF98088514D8F23
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti166 – 1661S → G in BAC11403. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti118 – 1181P → L.
    Corresponds to variant rs901754 [ dbSNP | Ensembl ].
    VAR_055478
    Natural varianti242 – 2421R → G.
    Corresponds to variant rs16939879 [ dbSNP | Ensembl ].
    VAR_059109

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei168 – 19124ESHSP…LEPEL → ASLWAVTLPTPPQSPIHPGT WTPRFSVIPWSSWSLSWFGQ in isoform 3. 2 PublicationsVSP_014088Add
    BLAST
    Alternative sequencei192 – 26877SSGQH…SVRLE → VWTEQRAASGGKRDPRNSPV PPTKKEGLRGSPPGPQELDV WLLGTVRALQESMQEVQARV QSLESMPRPPEQRPQPRPSA RPWPLGLPGPALLFFLLWPF VVQWLFRMFRTQKR in isoform 2. 2 PublicationsVSP_014089Add
    BLAST
    Alternative sequencei260 – 2689SLTLSVRLE → RGRSPGPVLGHGPLGSRGPR CSSSSCGPSSSSGSSECFGP KRGDCQWRGLCSQLRLSCCA LSLPRV in isoform 3. 2 PublicationsVSP_014090

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB073387 mRNA. Translation: BAD38638.1.
    AK023384 mRNA. Translation: BAB14553.1.
    AK075104 mRNA. Translation: BAC11403.1.
    CH471178 Genomic DNA. Translation: EAW51550.1.
    CH471178 Genomic DNA. Translation: EAW51551.1.
    CH471178 Genomic DNA. Translation: EAW51552.1.
    BC029164 mRNA. Translation: AAH29164.1.
    BC041143 mRNA. Translation: AAH41143.1.
    CCDSiCCDS42348.1. [Q8NC06-2]
    CCDS45710.1. [Q8NC06-3]
    CCDS45711.1. [Q8NC06-1]
    RefSeqiNP_001129176.1. NM_001135704.1. [Q8NC06-3]
    NP_001129177.1. NM_001135705.1. [Q8NC06-2]
    NP_001129178.1. NM_001135706.1. [Q8NC06-3]
    NP_001129179.1. NM_001135707.1. [Q8NC06-1]
    NP_078998.1. NM_024722.2. [Q8NC06-2]
    XP_005257734.1. XM_005257677.1. [Q8NC06-3]
    UniGeneiHs.110298.

    Genome annotation databases

    EnsembliENST00000321854; ENSP00000314440; ENSG00000181513. [Q8NC06-2]
    ENST00000376955; ENSP00000366154; ENSG00000181513. [Q8NC06-1]
    ENST00000398322; ENSP00000381367; ENSG00000181513. [Q8NC06-2]
    ENST00000431281; ENSP00000405969; ENSG00000181513. [Q8NC06-3]
    ENST00000586346; ENSP00000465484; ENSG00000181513. [Q8NC06-3]
    ENST00000591859; ENSP00000465610; ENSG00000181513. [Q8NC06-3]
    GeneIDi79777.
    KEGGihsa:79777.
    UCSCiuc002iic.3. human. [Q8NC06-2]
    uc002iid.2. human. [Q8NC06-1]
    uc002iie.3. human. [Q8NC06-3]

    Polymorphism databases

    DMDMi67460567.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB073387 mRNA. Translation: BAD38638.1 .
    AK023384 mRNA. Translation: BAB14553.1 .
    AK075104 mRNA. Translation: BAC11403.1 .
    CH471178 Genomic DNA. Translation: EAW51550.1 .
    CH471178 Genomic DNA. Translation: EAW51551.1 .
    CH471178 Genomic DNA. Translation: EAW51552.1 .
    BC029164 mRNA. Translation: AAH29164.1 .
    BC041143 mRNA. Translation: AAH41143.1 .
    CCDSi CCDS42348.1. [Q8NC06-2 ]
    CCDS45710.1. [Q8NC06-3 ]
    CCDS45711.1. [Q8NC06-1 ]
    RefSeqi NP_001129176.1. NM_001135704.1. [Q8NC06-3 ]
    NP_001129177.1. NM_001135705.1. [Q8NC06-2 ]
    NP_001129178.1. NM_001135706.1. [Q8NC06-3 ]
    NP_001129179.1. NM_001135707.1. [Q8NC06-1 ]
    NP_078998.1. NM_024722.2. [Q8NC06-2 ]
    XP_005257734.1. XM_005257677.1. [Q8NC06-3 ]
    UniGenei Hs.110298.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2WH5 X-ray 2.60 A/B/C/D/E/F 7-110 [» ]
    ProteinModelPortali Q8NC06.
    SMRi Q8NC06. Positions 13-102.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122878. 1 interaction.
    STRINGi 9606.ENSP00000314440.

    PTM databases

    PhosphoSitei Q8NC06.

    Polymorphism databases

    DMDMi 67460567.

    Proteomic databases

    MaxQBi Q8NC06.
    PaxDbi Q8NC06.
    PRIDEi Q8NC06.

    Protocols and materials databases

    DNASUi 79777.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000321854 ; ENSP00000314440 ; ENSG00000181513 . [Q8NC06-2 ]
    ENST00000376955 ; ENSP00000366154 ; ENSG00000181513 . [Q8NC06-1 ]
    ENST00000398322 ; ENSP00000381367 ; ENSG00000181513 . [Q8NC06-2 ]
    ENST00000431281 ; ENSP00000405969 ; ENSG00000181513 . [Q8NC06-3 ]
    ENST00000586346 ; ENSP00000465484 ; ENSG00000181513 . [Q8NC06-3 ]
    ENST00000591859 ; ENSP00000465610 ; ENSG00000181513 . [Q8NC06-3 ]
    GeneIDi 79777.
    KEGGi hsa:79777.
    UCSCi uc002iic.3. human. [Q8NC06-2 ]
    uc002iid.2. human. [Q8NC06-1 ]
    uc002iie.3. human. [Q8NC06-3 ]

    Organism-specific databases

    CTDi 79777.
    GeneCardsi GC17P043209.
    HGNCi HGNC:23337. ACBD4.
    HPAi HPA051772.
    neXtProti NX_Q8NC06.
    PharmGKBi PA134897893.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG4281.
    HOGENOMi HOG000231479.
    HOVERGENi HBG028530.
    OMAi IPWSSWS.
    OrthoDBi EOG7TJ3JP.
    PhylomeDBi Q8NC06.
    TreeFami TF319446.

    Miscellaneous databases

    EvolutionaryTracei Q8NC06.
    GenomeRNAii 79777.
    NextBioi 69267.
    PROi Q8NC06.

    Gene expression databases

    ArrayExpressi Q8NC06.
    Bgeei Q8NC06.
    CleanExi HS_ACBD4.
    Genevestigatori Q8NC06.

    Family and domain databases

    Gene3Di 1.20.80.10. 1 hit.
    InterProi IPR022408. Acyl-CoA-binding_prot_CS.
    IPR000582. Acyl-CoA-binding_protein.
    IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
    [Graphical view ]
    Pfami PF00887. ACBP. 1 hit.
    [Graphical view ]
    PRINTSi PR00689. ACOABINDINGP.
    SUPFAMi SSF47027. SSF47027. 1 hit.
    PROSITEi PS00880. ACB_1. 1 hit.
    PS51228. ACB_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
      Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
      Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Hepatoblastoma.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Ovary and Placenta.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
      Tissue: Brain and Colon.
    5. "Crystal structure of human acyl-CoA binding domain 4."
      Structural genomics consortium (SGC)
      Submitted (APR-2009) to the PDB data bank
      Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 7-110 IN COMPLEX WITH THE ACYL-COA STEAROYL-COENZYME A.

    Entry informationi

    Entry nameiACBD4_HUMAN
    AccessioniPrimary (citable) accession number: Q8NC06
    Secondary accession number(s): D3DX64, Q8IUT1, Q9H8Q4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 7, 2005
    Last sequence update: June 7, 2005
    Last modified: October 1, 2014
    This is version 95 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3