Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Acyl-CoA-binding domain-containing protein 4

Gene

ACBD4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Binds medium- and long-chain acyl-CoA esters and may function as an intracellular carrier of acyl-CoA esters.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei69 – 691Acyl-CoA
Binding sitei88 – 881Acyl-CoA

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Lipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Acyl-CoA-binding domain-containing protein 4
Gene namesi
Name:ACBD4
ORF Names:HMFT0700
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:23337. ACBD4.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134897893.

Polymorphism and mutation databases

BioMutaiACBD4.
DMDMi67460567.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 268268Acyl-CoA-binding domain-containing protein 4PRO_0000214032Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei166 – 1661Phosphoserine1 Publication
Modified residuei171 – 1711Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8NC06.
PaxDbiQ8NC06.
PRIDEiQ8NC06.

PTM databases

PhosphoSiteiQ8NC06.

Expressioni

Gene expression databases

BgeeiQ8NC06.
CleanExiHS_ACBD4.
ExpressionAtlasiQ8NC06. baseline.
GenevisibleiQ8NC06. HS.

Organism-specific databases

HPAiHPA051772.

Interactioni

Protein-protein interaction databases

BioGridi122878. 2 interactions.
STRINGi9606.ENSP00000405969.

Structurei

Secondary structure

1
268
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi14 – 2512Combined sources
Helixi36 – 5116Combined sources
Helixi64 – 7411Combined sources
Turni75 – 784Combined sources
Helixi81 – 10020Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2WH5X-ray2.60A/B/C/D/E/F7-110[»]
ProteinModelPortaliQ8NC06.
SMRiQ8NC06. Positions 13-102.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8NC06.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini12 – 10190ACBPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni23 – 3210Acyl-CoA binding
Regioni43 – 475Acyl-CoA binding

Sequence similaritiesi

Contains 1 ACB (acyl-CoA-binding) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG4281.
GeneTreeiENSGT00730000110900.
HOGENOMiHOG000231479.
HOVERGENiHBG028530.
InParanoidiQ8NC06.
OMAiIPWSSWS.
OrthoDBiEOG7TJ3JP.
PhylomeDBiQ8NC06.
TreeFamiTF319446.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
InterProiIPR022408. Acyl-CoA-binding_prot_CS.
IPR000582. Acyl-CoA-binding_protein.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
[Graphical view]
PfamiPF00887. ACBP. 1 hit.
[Graphical view]
PRINTSiPR00689. ACOABINDINGP.
SUPFAMiSSF47027. SSF47027. 1 hit.
PROSITEiPS00880. ACB_1. 1 hit.
PS51228. ACB_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NC06-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGTEKESPEP DCQKQFQAAV SVIQNLPKNG SYRPSYEEML RFYSYYKQAT
60 70 80 90 100
MGPCLVPRPG FWDPIGRYKW DAWNSLGKMS REEAMSAYIT EMKLVAQKVI
110 120 130 140 150
DTVPLGEVAE DMFGYFEPLY QVIPDMPRPP ETFLRRVTGW KEQVVNGDVG
160 170 180 190 200
AVSEPPCLPK EPAPPSPESH SPRDLDSEVF CDSLEQLEPE LSSGQHLEES
210 220 230 240 250
VIPGTAPCPP QRKRGCGAAR RGPRSWTCGC WGQFEHYRRA CRRCRRGCRA
260
WRACPGPLSS LTLSVRLE
Length:268
Mass (Da):30,308
Last modified:June 7, 2005 - v2
Checksum:i0F337D89924CDE2E
GO
Isoform 2 (identifier: Q8NC06-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     192-268: SSGQHLEESV...SSLTLSVRLE → VWTEQRAASG...LFRMFRTQKR

Show »
Length:305
Mass (Da):34,756
Checksum:i1EB97FF94E682547
GO
Isoform 3 (identifier: Q8NC06-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-191: ESHSPRDLDSEVFCDSLEQLEPEL → ASLWAVTLPTPPQSPIHPGTWTPRFSVIPWSSWSLSWFGQ
     260-268: SLTLSVRLE → RGRSPGPVLGHGPLGSRGPRCSSSSCGPSSSSGSSECFGPKRGDCQWRGLCSQLRLSCCALSLPRV

Show »
Length:341
Mass (Da):37,786
Checksum:iEFF98088514D8F23
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti166 – 1661S → G in BAC11403 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti118 – 1181P → L.
Corresponds to variant rs901754 [ dbSNP | Ensembl ].
VAR_055478
Natural varianti242 – 2421R → G.
Corresponds to variant rs16939879 [ dbSNP | Ensembl ].
VAR_059109

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei168 – 19124ESHSP…LEPEL → ASLWAVTLPTPPQSPIHPGT WTPRFSVIPWSSWSLSWFGQ in isoform 3. 2 PublicationsVSP_014088Add
BLAST
Alternative sequencei192 – 26877SSGQH…SVRLE → VWTEQRAASGGKRDPRNSPV PPTKKEGLRGSPPGPQELDV WLLGTVRALQESMQEVQARV QSLESMPRPPEQRPQPRPSA RPWPLGLPGPALLFFLLWPF VVQWLFRMFRTQKR in isoform 2. 2 PublicationsVSP_014089Add
BLAST
Alternative sequencei260 – 2689SLTLSVRLE → RGRSPGPVLGHGPLGSRGPR CSSSSCGPSSSSGSSECFGP KRGDCQWRGLCSQLRLSCCA LSLPRV in isoform 3. 2 PublicationsVSP_014090

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB073387 mRNA. Translation: BAD38638.1.
AK023384 mRNA. Translation: BAB14553.1.
AK075104 mRNA. Translation: BAC11403.1.
CH471178 Genomic DNA. Translation: EAW51550.1.
CH471178 Genomic DNA. Translation: EAW51551.1.
CH471178 Genomic DNA. Translation: EAW51552.1.
BC029164 mRNA. Translation: AAH29164.1.
BC041143 mRNA. Translation: AAH41143.1.
CCDSiCCDS42348.1. [Q8NC06-2]
CCDS45710.1. [Q8NC06-3]
CCDS45711.1. [Q8NC06-1]
RefSeqiNP_001129176.1. NM_001135704.1. [Q8NC06-3]
NP_001129177.1. NM_001135705.1. [Q8NC06-2]
NP_001129178.1. NM_001135706.1. [Q8NC06-3]
NP_001129179.1. NM_001135707.1. [Q8NC06-1]
NP_078998.1. NM_024722.2. [Q8NC06-2]
XP_005257734.1. XM_005257677.1. [Q8NC06-3]
UniGeneiHs.110298.

Genome annotation databases

EnsembliENST00000321854; ENSP00000314440; ENSG00000181513. [Q8NC06-2]
ENST00000376955; ENSP00000366154; ENSG00000181513. [Q8NC06-1]
ENST00000398322; ENSP00000381367; ENSG00000181513. [Q8NC06-2]
ENST00000431281; ENSP00000405969; ENSG00000181513. [Q8NC06-3]
ENST00000586346; ENSP00000465484; ENSG00000181513. [Q8NC06-3]
ENST00000591859; ENSP00000465610; ENSG00000181513. [Q8NC06-3]
ENST00000619916; ENSP00000482750; ENSG00000181513. [Q8NC06-1]
GeneIDi79777.
KEGGihsa:79777.
UCSCiuc002iic.3. human. [Q8NC06-2]
uc002iid.2. human. [Q8NC06-1]
uc002iie.3. human. [Q8NC06-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB073387 mRNA. Translation: BAD38638.1.
AK023384 mRNA. Translation: BAB14553.1.
AK075104 mRNA. Translation: BAC11403.1.
CH471178 Genomic DNA. Translation: EAW51550.1.
CH471178 Genomic DNA. Translation: EAW51551.1.
CH471178 Genomic DNA. Translation: EAW51552.1.
BC029164 mRNA. Translation: AAH29164.1.
BC041143 mRNA. Translation: AAH41143.1.
CCDSiCCDS42348.1. [Q8NC06-2]
CCDS45710.1. [Q8NC06-3]
CCDS45711.1. [Q8NC06-1]
RefSeqiNP_001129176.1. NM_001135704.1. [Q8NC06-3]
NP_001129177.1. NM_001135705.1. [Q8NC06-2]
NP_001129178.1. NM_001135706.1. [Q8NC06-3]
NP_001129179.1. NM_001135707.1. [Q8NC06-1]
NP_078998.1. NM_024722.2. [Q8NC06-2]
XP_005257734.1. XM_005257677.1. [Q8NC06-3]
UniGeneiHs.110298.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2WH5X-ray2.60A/B/C/D/E/F7-110[»]
ProteinModelPortaliQ8NC06.
SMRiQ8NC06. Positions 13-102.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122878. 2 interactions.
STRINGi9606.ENSP00000405969.

PTM databases

PhosphoSiteiQ8NC06.

Polymorphism and mutation databases

BioMutaiACBD4.
DMDMi67460567.

Proteomic databases

MaxQBiQ8NC06.
PaxDbiQ8NC06.
PRIDEiQ8NC06.

Protocols and materials databases

DNASUi79777.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000321854; ENSP00000314440; ENSG00000181513. [Q8NC06-2]
ENST00000376955; ENSP00000366154; ENSG00000181513. [Q8NC06-1]
ENST00000398322; ENSP00000381367; ENSG00000181513. [Q8NC06-2]
ENST00000431281; ENSP00000405969; ENSG00000181513. [Q8NC06-3]
ENST00000586346; ENSP00000465484; ENSG00000181513. [Q8NC06-3]
ENST00000591859; ENSP00000465610; ENSG00000181513. [Q8NC06-3]
ENST00000619916; ENSP00000482750; ENSG00000181513. [Q8NC06-1]
GeneIDi79777.
KEGGihsa:79777.
UCSCiuc002iic.3. human. [Q8NC06-2]
uc002iid.2. human. [Q8NC06-1]
uc002iie.3. human. [Q8NC06-3]

Organism-specific databases

CTDi79777.
GeneCardsiGC17P043209.
HGNCiHGNC:23337. ACBD4.
HPAiHPA051772.
neXtProtiNX_Q8NC06.
PharmGKBiPA134897893.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG4281.
GeneTreeiENSGT00730000110900.
HOGENOMiHOG000231479.
HOVERGENiHBG028530.
InParanoidiQ8NC06.
OMAiIPWSSWS.
OrthoDBiEOG7TJ3JP.
PhylomeDBiQ8NC06.
TreeFamiTF319446.

Miscellaneous databases

ChiTaRSiACBD4. human.
EvolutionaryTraceiQ8NC06.
GenomeRNAii79777.
NextBioi69267.
PROiQ8NC06.

Gene expression databases

BgeeiQ8NC06.
CleanExiHS_ACBD4.
ExpressionAtlasiQ8NC06. baseline.
GenevisibleiQ8NC06. HS.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
InterProiIPR022408. Acyl-CoA-binding_prot_CS.
IPR000582. Acyl-CoA-binding_protein.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
[Graphical view]
PfamiPF00887. ACBP. 1 hit.
[Graphical view]
PRINTSiPR00689. ACOABINDINGP.
SUPFAMiSSF47027. SSF47027. 1 hit.
PROSITEiPS00880. ACB_1. 1 hit.
PS51228. ACB_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
    Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
    Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Hepatoblastoma.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Ovary and Placenta.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain and Colon.
  5. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-166 AND SER-171, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  6. "Crystal structure of human acyl-CoA binding domain 4."
    Structural genomics consortium (SGC)
    Submitted (APR-2009) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 7-110 IN COMPLEX WITH THE ACYL-COA STEAROYL-COENZYME A.

Entry informationi

Entry nameiACBD4_HUMAN
AccessioniPrimary (citable) accession number: Q8NC06
Secondary accession number(s): D3DX64, Q8IUT1, Q9H8Q4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: June 7, 2005
Last modified: June 24, 2015
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.