Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Acyl-CoA-binding domain-containing protein 4

Gene

ACBD4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Binds medium- and long-chain acyl-CoA esters and may function as an intracellular carrier of acyl-CoA esters.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei69Acyl-CoA1
Binding sitei88Acyl-CoA1

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Lipid-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000087391-MONOMER.
ReactomeiR-HSA-390918. Peroxisomal lipid metabolism.

Names & Taxonomyi

Protein namesi
Recommended name:
Acyl-CoA-binding domain-containing protein 4
Gene namesi
Name:ACBD4
ORF Names:HMFT0700
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:23337. ACBD4.

Pathology & Biotechi

Organism-specific databases

DisGeNETi79777.
OpenTargetsiENSG00000181513.
PharmGKBiPA134897893.

Polymorphism and mutation databases

BioMutaiACBD4.
DMDMi67460567.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002140321 – 268Acyl-CoA-binding domain-containing protein 4Add BLAST268

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei166PhosphoserineCombined sources1
Modified residuei171PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8NC06.
PeptideAtlasiQ8NC06.
PRIDEiQ8NC06.

PTM databases

iPTMnetiQ8NC06.
PhosphoSitePlusiQ8NC06.

Expressioni

Gene expression databases

BgeeiENSG00000181513.
CleanExiHS_ACBD4.
ExpressionAtlasiQ8NC06. baseline and differential.
GenevisibleiQ8NC06. HS.

Organism-specific databases

HPAiHPA051772.

Interactioni

Protein-protein interaction databases

BioGridi122878. 3 interactors.
IntActiQ8NC06. 1 interactor.

Structurei

Secondary structure

1268
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi14 – 25Combined sources12
Helixi36 – 51Combined sources16
Helixi64 – 74Combined sources11
Turni75 – 78Combined sources4
Helixi81 – 100Combined sources20

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WH5X-ray2.60A/B/C/D/E/F7-110[»]
ProteinModelPortaliQ8NC06.
SMRiQ8NC06.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ8NC06.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini12 – 101ACBPROSITE-ProRule annotationAdd BLAST90

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni23 – 32Acyl-CoA binding10
Regioni43 – 47Acyl-CoA binding5

Sequence similaritiesi

Contains 1 ACB (acyl-CoA-binding) domain.PROSITE-ProRule annotation

Phylogenomic databases

GeneTreeiENSGT00840000129776.
HOGENOMiHOG000231479.
HOVERGENiHBG028530.
InParanoidiQ8NC06.
OMAiIPWSSWS.
OrthoDBiEOG091G0NXJ.
PhylomeDBiQ8NC06.
TreeFamiTF319446.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
InterProiIPR022408. Acyl-CoA-binding_prot_CS.
IPR000582. Acyl-CoA-binding_protein.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
[Graphical view]
PfamiPF00887. ACBP. 1 hit.
[Graphical view]
PRINTSiPR00689. ACOABINDINGP.
SUPFAMiSSF47027. SSF47027. 1 hit.
PROSITEiPS00880. ACB_1. 1 hit.
PS51228. ACB_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NC06-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGTEKESPEP DCQKQFQAAV SVIQNLPKNG SYRPSYEEML RFYSYYKQAT
60 70 80 90 100
MGPCLVPRPG FWDPIGRYKW DAWNSLGKMS REEAMSAYIT EMKLVAQKVI
110 120 130 140 150
DTVPLGEVAE DMFGYFEPLY QVIPDMPRPP ETFLRRVTGW KEQVVNGDVG
160 170 180 190 200
AVSEPPCLPK EPAPPSPESH SPRDLDSEVF CDSLEQLEPE LSSGQHLEES
210 220 230 240 250
VIPGTAPCPP QRKRGCGAAR RGPRSWTCGC WGQFEHYRRA CRRCRRGCRA
260
WRACPGPLSS LTLSVRLE
Length:268
Mass (Da):30,308
Last modified:June 7, 2005 - v2
Checksum:i0F337D89924CDE2E
GO
Isoform 2 (identifier: Q8NC06-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     192-268: SSGQHLEESV...SSLTLSVRLE → VWTEQRAASG...LFRMFRTQKR

Show »
Length:305
Mass (Da):34,756
Checksum:i1EB97FF94E682547
GO
Isoform 3 (identifier: Q8NC06-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-191: ESHSPRDLDSEVFCDSLEQLEPEL → ASLWAVTLPTPPQSPIHPGTWTPRFSVIPWSSWSLSWFGQ
     260-268: SLTLSVRLE → RGRSPGPVLGHGPLGSRGPRCSSSSCGPSSSSGSSECFGPKRGDCQWRGLCSQLRLSCCALSLPRV

Show »
Length:341
Mass (Da):37,786
Checksum:iEFF98088514D8F23
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti166S → G in BAC11403 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_055478118P → L.Corresponds to variant rs901754dbSNPEnsembl.1
Natural variantiVAR_059109242R → G.Corresponds to variant rs16939879dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_014088168 – 191ESHSP…LEPEL → ASLWAVTLPTPPQSPIHPGT WTPRFSVIPWSSWSLSWFGQ in isoform 3. 2 PublicationsAdd BLAST24
Alternative sequenceiVSP_014089192 – 268SSGQH…SVRLE → VWTEQRAASGGKRDPRNSPV PPTKKEGLRGSPPGPQELDV WLLGTVRALQESMQEVQARV QSLESMPRPPEQRPQPRPSA RPWPLGLPGPALLFFLLWPF VVQWLFRMFRTQKR in isoform 2. 2 PublicationsAdd BLAST77
Alternative sequenceiVSP_014090260 – 268SLTLSVRLE → RGRSPGPVLGHGPLGSRGPR CSSSSCGPSSSSGSSECFGP KRGDCQWRGLCSQLRLSCCA LSLPRV in isoform 3. 2 Publications9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB073387 mRNA. Translation: BAD38638.1.
AK023384 mRNA. Translation: BAB14553.1.
AK075104 mRNA. Translation: BAC11403.1.
CH471178 Genomic DNA. Translation: EAW51550.1.
CH471178 Genomic DNA. Translation: EAW51551.1.
CH471178 Genomic DNA. Translation: EAW51552.1.
BC029164 mRNA. Translation: AAH29164.1.
BC041143 mRNA. Translation: AAH41143.1.
CCDSiCCDS42348.1. [Q8NC06-2]
CCDS45710.1. [Q8NC06-3]
CCDS45711.1. [Q8NC06-1]
RefSeqiNP_001129177.1. NM_001135705.2. [Q8NC06-2]
NP_001129178.1. NM_001135706.2. [Q8NC06-3]
NP_001129179.1. NM_001135707.2. [Q8NC06-1]
NP_001308281.1. NM_001321352.1. [Q8NC06-3]
NP_001308282.1. NM_001321353.1. [Q8NC06-3]
NP_078998.1. NM_024722.3. [Q8NC06-2]
XP_016880577.1. XM_017025088.1. [Q8NC06-3]
XP_016880580.1. XM_017025091.1. [Q8NC06-2]
XP_016880581.1. XM_017025092.1. [Q8NC06-2]
UniGeneiHs.110298.

Genome annotation databases

EnsembliENST00000321854; ENSP00000314440; ENSG00000181513. [Q8NC06-2]
ENST00000376955; ENSP00000366154; ENSG00000181513. [Q8NC06-1]
ENST00000398322; ENSP00000381367; ENSG00000181513. [Q8NC06-2]
ENST00000431281; ENSP00000405969; ENSG00000181513. [Q8NC06-3]
ENST00000586346; ENSP00000465484; ENSG00000181513. [Q8NC06-3]
ENST00000591859; ENSP00000465610; ENSG00000181513. [Q8NC06-3]
ENST00000619916; ENSP00000482750; ENSG00000181513. [Q8NC06-1]
GeneIDi79777.
KEGGihsa:79777.
UCSCiuc002iic.4. human. [Q8NC06-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB073387 mRNA. Translation: BAD38638.1.
AK023384 mRNA. Translation: BAB14553.1.
AK075104 mRNA. Translation: BAC11403.1.
CH471178 Genomic DNA. Translation: EAW51550.1.
CH471178 Genomic DNA. Translation: EAW51551.1.
CH471178 Genomic DNA. Translation: EAW51552.1.
BC029164 mRNA. Translation: AAH29164.1.
BC041143 mRNA. Translation: AAH41143.1.
CCDSiCCDS42348.1. [Q8NC06-2]
CCDS45710.1. [Q8NC06-3]
CCDS45711.1. [Q8NC06-1]
RefSeqiNP_001129177.1. NM_001135705.2. [Q8NC06-2]
NP_001129178.1. NM_001135706.2. [Q8NC06-3]
NP_001129179.1. NM_001135707.2. [Q8NC06-1]
NP_001308281.1. NM_001321352.1. [Q8NC06-3]
NP_001308282.1. NM_001321353.1. [Q8NC06-3]
NP_078998.1. NM_024722.3. [Q8NC06-2]
XP_016880577.1. XM_017025088.1. [Q8NC06-3]
XP_016880580.1. XM_017025091.1. [Q8NC06-2]
XP_016880581.1. XM_017025092.1. [Q8NC06-2]
UniGeneiHs.110298.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2WH5X-ray2.60A/B/C/D/E/F7-110[»]
ProteinModelPortaliQ8NC06.
SMRiQ8NC06.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122878. 3 interactors.
IntActiQ8NC06. 1 interactor.

PTM databases

iPTMnetiQ8NC06.
PhosphoSitePlusiQ8NC06.

Polymorphism and mutation databases

BioMutaiACBD4.
DMDMi67460567.

Proteomic databases

MaxQBiQ8NC06.
PeptideAtlasiQ8NC06.
PRIDEiQ8NC06.

Protocols and materials databases

DNASUi79777.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000321854; ENSP00000314440; ENSG00000181513. [Q8NC06-2]
ENST00000376955; ENSP00000366154; ENSG00000181513. [Q8NC06-1]
ENST00000398322; ENSP00000381367; ENSG00000181513. [Q8NC06-2]
ENST00000431281; ENSP00000405969; ENSG00000181513. [Q8NC06-3]
ENST00000586346; ENSP00000465484; ENSG00000181513. [Q8NC06-3]
ENST00000591859; ENSP00000465610; ENSG00000181513. [Q8NC06-3]
ENST00000619916; ENSP00000482750; ENSG00000181513. [Q8NC06-1]
GeneIDi79777.
KEGGihsa:79777.
UCSCiuc002iic.4. human. [Q8NC06-1]

Organism-specific databases

CTDi79777.
DisGeNETi79777.
GeneCardsiACBD4.
HGNCiHGNC:23337. ACBD4.
HPAiHPA051772.
neXtProtiNX_Q8NC06.
OpenTargetsiENSG00000181513.
PharmGKBiPA134897893.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00840000129776.
HOGENOMiHOG000231479.
HOVERGENiHBG028530.
InParanoidiQ8NC06.
OMAiIPWSSWS.
OrthoDBiEOG091G0NXJ.
PhylomeDBiQ8NC06.
TreeFamiTF319446.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000087391-MONOMER.
ReactomeiR-HSA-390918. Peroxisomal lipid metabolism.

Miscellaneous databases

ChiTaRSiACBD4. human.
EvolutionaryTraceiQ8NC06.
GenomeRNAii79777.
PROiQ8NC06.

Gene expression databases

BgeeiENSG00000181513.
CleanExiHS_ACBD4.
ExpressionAtlasiQ8NC06. baseline and differential.
GenevisibleiQ8NC06. HS.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
InterProiIPR022408. Acyl-CoA-binding_prot_CS.
IPR000582. Acyl-CoA-binding_protein.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
[Graphical view]
PfamiPF00887. ACBP. 1 hit.
[Graphical view]
PRINTSiPR00689. ACOABINDINGP.
SUPFAMiSSF47027. SSF47027. 1 hit.
PROSITEiPS00880. ACB_1. 1 hit.
PS51228. ACB_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiACBD4_HUMAN
AccessioniPrimary (citable) accession number: Q8NC06
Secondary accession number(s): D3DX64, Q8IUT1, Q9H8Q4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: June 7, 2005
Last modified: November 2, 2016
This is version 116 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.