Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NC06 (ACBD4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 91. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Acyl-CoA-binding domain-containing protein 4
Gene names
Name:ACBD4
ORF Names:HMFT0700
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length268 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Binds medium- and long-chain acyl-CoA esters and may function as an intracellular carrier of acyl-CoA esters.

Sequence similarities

Contains 1 ACB (acyl-CoA-binding) domain.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandLipid-binding
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Molecular_functionfatty-acyl-CoA binding

Inferred from electronic annotation. Source: InterPro

lipid binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8NC06-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8NC06-2)

The sequence of this isoform differs from the canonical sequence as follows:
     192-268: SSGQHLEESV...SSLTLSVRLE → VWTEQRAASG...LFRMFRTQKR
Isoform 3 (identifier: Q8NC06-3)

The sequence of this isoform differs from the canonical sequence as follows:
     168-191: ESHSPRDLDSEVFCDSLEQLEPEL → ASLWAVTLPTPPQSPIHPGTWTPRFSVIPWSSWSLSWFGQ
     260-268: SLTLSVRLE → RGRSPGPVLGHGPLGSRGPRCSSSSCGPSSSSGSSECFGPKRGDCQWRGLCSQLRLSCCALSLPRV

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 268268Acyl-CoA-binding domain-containing protein 4
PRO_0000214032

Regions

Domain12 – 10190ACB
Region23 – 3210Acyl-CoA binding
Region43 – 475Acyl-CoA binding

Sites

Binding site691Acyl-CoA
Binding site881Acyl-CoA

Natural variations

Alternative sequence168 – 19124ESHSP…LEPEL → ASLWAVTLPTPPQSPIHPGT WTPRFSVIPWSSWSLSWFGQ in isoform 3.
VSP_014088
Alternative sequence192 – 26877SSGQH…SVRLE → VWTEQRAASGGKRDPRNSPV PPTKKEGLRGSPPGPQELDV WLLGTVRALQESMQEVQARV QSLESMPRPPEQRPQPRPSA RPWPLGLPGPALLFFLLWPF VVQWLFRMFRTQKR in isoform 2.
VSP_014089
Alternative sequence260 – 2689SLTLSVRLE → RGRSPGPVLGHGPLGSRGPR CSSSSCGPSSSSGSSECFGP KRGDCQWRGLCSQLRLSCCA LSLPRV in isoform 3.
VSP_014090
Natural variant1181P → L.
Corresponds to variant rs901754 [ dbSNP | Ensembl ].
VAR_055478
Natural variant2421R → G.
Corresponds to variant rs16939879 [ dbSNP | Ensembl ].
VAR_059109

Experimental info

Sequence conflict1661S → G in BAC11403. Ref.2

Secondary structure

.......... 268
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 7, 2005. Version 2.
Checksum: 0F337D89924CDE2E

FASTA26830,308
        10         20         30         40         50         60 
MGTEKESPEP DCQKQFQAAV SVIQNLPKNG SYRPSYEEML RFYSYYKQAT MGPCLVPRPG 

        70         80         90        100        110        120 
FWDPIGRYKW DAWNSLGKMS REEAMSAYIT EMKLVAQKVI DTVPLGEVAE DMFGYFEPLY 

       130        140        150        160        170        180 
QVIPDMPRPP ETFLRRVTGW KEQVVNGDVG AVSEPPCLPK EPAPPSPESH SPRDLDSEVF 

       190        200        210        220        230        240 
CDSLEQLEPE LSSGQHLEES VIPGTAPCPP QRKRGCGAAR RGPRSWTCGC WGQFEHYRRA 

       250        260 
CRRCRRGCRA WRACPGPLSS LTLSVRLE 

« Hide

Isoform 2 [UniParc].

Checksum: 1EB97FF94E682547
Show »

FASTA30534,756
Isoform 3 [UniParc].

Checksum: EFF98088514D8F23
Show »

FASTA34137,786

References

« Hide 'large scale' references
[1]"Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Hepatoblastoma.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Ovary and Placenta.
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
Tissue: Brain and Colon.
[5]"Crystal structure of human acyl-CoA binding domain 4."
Structural genomics consortium (SGC)
Submitted (APR-2009) to the PDB data bank
Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 7-110 IN COMPLEX WITH STEAROYL-COENZYME A.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB073387 mRNA. Translation: BAD38638.1.
AK023384 mRNA. Translation: BAB14553.1.
AK075104 mRNA. Translation: BAC11403.1.
CH471178 Genomic DNA. Translation: EAW51550.1.
CH471178 Genomic DNA. Translation: EAW51551.1.
CH471178 Genomic DNA. Translation: EAW51552.1.
BC029164 mRNA. Translation: AAH29164.1.
BC041143 mRNA. Translation: AAH41143.1.
RefSeqNP_001129176.1. NM_001135704.1.
NP_001129177.1. NM_001135705.1.
NP_001129178.1. NM_001135706.1.
NP_001129179.1. NM_001135707.1.
NP_078998.1. NM_024722.2.
XP_005257734.1. XM_005257677.1.
XP_005257736.1. XM_005257679.1.
XP_005257737.1. XM_005257680.1.
XP_005257741.1. XM_005257684.1.
UniGeneHs.110298.

3D structure databases

PDBe
RCSB PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2WH5X-ray2.60A/B/C/D/E/F7-110[»]
ProteinModelPortalQ8NC06.
SMRQ8NC06. Positions 13-102.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122878. 1 interaction.
STRING9606.ENSP00000314440.

PTM databases

PhosphoSiteQ8NC06.

Polymorphism databases

DMDM67460567.

Proteomic databases

PaxDbQ8NC06.
PRIDEQ8NC06.

Protocols and materials databases

DNASU79777.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000321854; ENSP00000314440; ENSG00000181513. [Q8NC06-2]
ENST00000376955; ENSP00000366154; ENSG00000181513. [Q8NC06-1]
ENST00000398322; ENSP00000381367; ENSG00000181513. [Q8NC06-2]
ENST00000431281; ENSP00000405969; ENSG00000181513. [Q8NC06-3]
ENST00000586346; ENSP00000465484; ENSG00000181513. [Q8NC06-3]
ENST00000591859; ENSP00000465610; ENSG00000181513. [Q8NC06-3]
GeneID79777.
KEGGhsa:79777.
UCSCuc002iic.3. human. [Q8NC06-2]
uc002iid.2. human. [Q8NC06-1]
uc002iie.3. human. [Q8NC06-3]

Organism-specific databases

CTD79777.
GeneCardsGC17P043209.
HGNCHGNC:23337. ACBD4.
HPAHPA051772.
neXtProtNX_Q8NC06.
PharmGKBPA134897893.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG4281.
HOGENOMHOG000231479.
HOVERGENHBG028530.
OMAIPWSSWS.
OrthoDBEOG7TJ3JP.
TreeFamTF319446.

Gene expression databases

ArrayExpressQ8NC06.
BgeeQ8NC06.
CleanExHS_ACBD4.
GenevestigatorQ8NC06.

Family and domain databases

Gene3D1.20.80.10. 1 hit.
InterProIPR022408. Acyl-CoA-binding_prot_CS.
IPR000582. Acyl-CoA-binding_protein.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
[Graphical view]
PfamPF00887. ACBP. 1 hit.
[Graphical view]
PRINTSPR00689. ACOABINDINGP.
SUPFAMSSF47027. SSF47027. 1 hit.
PROSITEPS00880. ACB_1. 1 hit.
PS51228. ACB_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ8NC06.
GenomeRNAi79777.
NextBio69267.
PROQ8NC06.

Entry information

Entry nameACBD4_HUMAN
AccessionPrimary (citable) accession number: Q8NC06
Secondary accession number(s): D3DX64, Q8IUT1, Q9H8Q4
Entry history
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: June 7, 2005
Last modified: March 19, 2014
This is version 91 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 17

Human chromosome 17: entries, gene names and cross-references to MIM