SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NC06

- ACBD4_HUMAN

UniProt

Q8NC06 - ACBD4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Acyl-CoA-binding domain-containing protein 4
Gene
ACBD4, HMFT0700
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Functioni

Binds medium- and long-chain acyl-CoA esters and may function as an intracellular carrier of acyl-CoA esters.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei69 – 691Acyl-CoA
Binding sitei88 – 881Acyl-CoA

GO - Molecular functioni

  1. fatty-acyl-CoA binding Source: InterPro
  2. lipid binding Source: UniProtKB-KW
Complete GO annotation...

Keywords - Ligandi

Lipid-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Acyl-CoA-binding domain-containing protein 4
Gene namesi
Name:ACBD4
ORF Names:HMFT0700
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:23337. ACBD4.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134897893.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 268268Acyl-CoA-binding domain-containing protein 4
PRO_0000214032Add
BLAST

Proteomic databases

MaxQBiQ8NC06.
PaxDbiQ8NC06.
PRIDEiQ8NC06.

PTM databases

PhosphoSiteiQ8NC06.

Expressioni

Gene expression databases

ArrayExpressiQ8NC06.
BgeeiQ8NC06.
CleanExiHS_ACBD4.
GenevestigatoriQ8NC06.

Organism-specific databases

HPAiHPA051772.

Interactioni

Protein-protein interaction databases

BioGridi122878. 1 interaction.
STRINGi9606.ENSP00000314440.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi14 – 2512
Helixi36 – 5116
Helixi64 – 7411
Turni75 – 784
Helixi81 – 10020

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2WH5X-ray2.60A/B/C/D/E/F7-110[»]
ProteinModelPortaliQ8NC06.
SMRiQ8NC06. Positions 13-102.

Miscellaneous databases

EvolutionaryTraceiQ8NC06.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini12 – 10190ACB
Add
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni23 – 3210Acyl-CoA binding
Regioni43 – 475Acyl-CoA binding

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG4281.
HOGENOMiHOG000231479.
HOVERGENiHBG028530.
OMAiIPWSSWS.
OrthoDBiEOG7TJ3JP.
PhylomeDBiQ8NC06.
TreeFamiTF319446.

Family and domain databases

Gene3Di1.20.80.10. 1 hit.
InterProiIPR022408. Acyl-CoA-binding_prot_CS.
IPR000582. Acyl-CoA-binding_protein.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
[Graphical view]
PfamiPF00887. ACBP. 1 hit.
[Graphical view]
PRINTSiPR00689. ACOABINDINGP.
SUPFAMiSSF47027. SSF47027. 1 hit.
PROSITEiPS00880. ACB_1. 1 hit.
PS51228. ACB_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8NC06-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGTEKESPEP DCQKQFQAAV SVIQNLPKNG SYRPSYEEML RFYSYYKQAT    50
MGPCLVPRPG FWDPIGRYKW DAWNSLGKMS REEAMSAYIT EMKLVAQKVI 100
DTVPLGEVAE DMFGYFEPLY QVIPDMPRPP ETFLRRVTGW KEQVVNGDVG 150
AVSEPPCLPK EPAPPSPESH SPRDLDSEVF CDSLEQLEPE LSSGQHLEES 200
VIPGTAPCPP QRKRGCGAAR RGPRSWTCGC WGQFEHYRRA CRRCRRGCRA 250
WRACPGPLSS LTLSVRLE 268
Length:268
Mass (Da):30,308
Last modified:June 7, 2005 - v2
Checksum:i0F337D89924CDE2E
GO
Isoform 2 (identifier: Q8NC06-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     192-268: SSGQHLEESV...SSLTLSVRLE → VWTEQRAASG...LFRMFRTQKR

Show »
Length:305
Mass (Da):34,756
Checksum:i1EB97FF94E682547
GO
Isoform 3 (identifier: Q8NC06-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-191: ESHSPRDLDSEVFCDSLEQLEPEL → ASLWAVTLPTPPQSPIHPGTWTPRFSVIPWSSWSLSWFGQ
     260-268: SLTLSVRLE → RGRSPGPVLGHGPLGSRGPRCSSSSCGPSSSSGSSECFGPKRGDCQWRGLCSQLRLSCCALSLPRV

Show »
Length:341
Mass (Da):37,786
Checksum:iEFF98088514D8F23
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti118 – 1181P → L.
Corresponds to variant rs901754 [ dbSNP | Ensembl ].
VAR_055478
Natural varianti242 – 2421R → G.
Corresponds to variant rs16939879 [ dbSNP | Ensembl ].
VAR_059109

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei168 – 19124ESHSP…LEPEL → ASLWAVTLPTPPQSPIHPGT WTPRFSVIPWSSWSLSWFGQ in isoform 3.
VSP_014088Add
BLAST
Alternative sequencei192 – 26877SSGQH…SVRLE → VWTEQRAASGGKRDPRNSPV PPTKKEGLRGSPPGPQELDV WLLGTVRALQESMQEVQARV QSLESMPRPPEQRPQPRPSA RPWPLGLPGPALLFFLLWPF VVQWLFRMFRTQKR in isoform 2.
VSP_014089Add
BLAST
Alternative sequencei260 – 2689SLTLSVRLE → RGRSPGPVLGHGPLGSRGPR CSSSSCGPSSSSGSSECFGP KRGDCQWRGLCSQLRLSCCA LSLPRV in isoform 3.
VSP_014090

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti166 – 1661S → G in BAC11403. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB073387 mRNA. Translation: BAD38638.1.
AK023384 mRNA. Translation: BAB14553.1.
AK075104 mRNA. Translation: BAC11403.1.
CH471178 Genomic DNA. Translation: EAW51550.1.
CH471178 Genomic DNA. Translation: EAW51551.1.
CH471178 Genomic DNA. Translation: EAW51552.1.
BC029164 mRNA. Translation: AAH29164.1.
BC041143 mRNA. Translation: AAH41143.1.
CCDSiCCDS42348.1. [Q8NC06-2]
CCDS45710.1. [Q8NC06-3]
CCDS45711.1. [Q8NC06-1]
RefSeqiNP_001129176.1. NM_001135704.1. [Q8NC06-3]
NP_001129177.1. NM_001135705.1. [Q8NC06-2]
NP_001129178.1. NM_001135706.1. [Q8NC06-3]
NP_001129179.1. NM_001135707.1. [Q8NC06-1]
NP_078998.1. NM_024722.2. [Q8NC06-2]
XP_005257734.1. XM_005257677.1. [Q8NC06-3]
UniGeneiHs.110298.

Genome annotation databases

EnsembliENST00000321854; ENSP00000314440; ENSG00000181513. [Q8NC06-2]
ENST00000376955; ENSP00000366154; ENSG00000181513. [Q8NC06-1]
ENST00000398322; ENSP00000381367; ENSG00000181513. [Q8NC06-2]
ENST00000431281; ENSP00000405969; ENSG00000181513. [Q8NC06-3]
ENST00000586346; ENSP00000465484; ENSG00000181513. [Q8NC06-3]
ENST00000591859; ENSP00000465610; ENSG00000181513. [Q8NC06-3]
GeneIDi79777.
KEGGihsa:79777.
UCSCiuc002iic.3. human. [Q8NC06-2]
uc002iid.2. human. [Q8NC06-1]
uc002iie.3. human. [Q8NC06-3]

Polymorphism databases

DMDMi67460567.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB073387 mRNA. Translation: BAD38638.1 .
AK023384 mRNA. Translation: BAB14553.1 .
AK075104 mRNA. Translation: BAC11403.1 .
CH471178 Genomic DNA. Translation: EAW51550.1 .
CH471178 Genomic DNA. Translation: EAW51551.1 .
CH471178 Genomic DNA. Translation: EAW51552.1 .
BC029164 mRNA. Translation: AAH29164.1 .
BC041143 mRNA. Translation: AAH41143.1 .
CCDSi CCDS42348.1. [Q8NC06-2 ]
CCDS45710.1. [Q8NC06-3 ]
CCDS45711.1. [Q8NC06-1 ]
RefSeqi NP_001129176.1. NM_001135704.1. [Q8NC06-3 ]
NP_001129177.1. NM_001135705.1. [Q8NC06-2 ]
NP_001129178.1. NM_001135706.1. [Q8NC06-3 ]
NP_001129179.1. NM_001135707.1. [Q8NC06-1 ]
NP_078998.1. NM_024722.2. [Q8NC06-2 ]
XP_005257734.1. XM_005257677.1. [Q8NC06-3 ]
UniGenei Hs.110298.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2WH5 X-ray 2.60 A/B/C/D/E/F 7-110 [» ]
ProteinModelPortali Q8NC06.
SMRi Q8NC06. Positions 13-102.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122878. 1 interaction.
STRINGi 9606.ENSP00000314440.

PTM databases

PhosphoSitei Q8NC06.

Polymorphism databases

DMDMi 67460567.

Proteomic databases

MaxQBi Q8NC06.
PaxDbi Q8NC06.
PRIDEi Q8NC06.

Protocols and materials databases

DNASUi 79777.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000321854 ; ENSP00000314440 ; ENSG00000181513 . [Q8NC06-2 ]
ENST00000376955 ; ENSP00000366154 ; ENSG00000181513 . [Q8NC06-1 ]
ENST00000398322 ; ENSP00000381367 ; ENSG00000181513 . [Q8NC06-2 ]
ENST00000431281 ; ENSP00000405969 ; ENSG00000181513 . [Q8NC06-3 ]
ENST00000586346 ; ENSP00000465484 ; ENSG00000181513 . [Q8NC06-3 ]
ENST00000591859 ; ENSP00000465610 ; ENSG00000181513 . [Q8NC06-3 ]
GeneIDi 79777.
KEGGi hsa:79777.
UCSCi uc002iic.3. human. [Q8NC06-2 ]
uc002iid.2. human. [Q8NC06-1 ]
uc002iie.3. human. [Q8NC06-3 ]

Organism-specific databases

CTDi 79777.
GeneCardsi GC17P043209.
HGNCi HGNC:23337. ACBD4.
HPAi HPA051772.
neXtProti NX_Q8NC06.
PharmGKBi PA134897893.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG4281.
HOGENOMi HOG000231479.
HOVERGENi HBG028530.
OMAi IPWSSWS.
OrthoDBi EOG7TJ3JP.
PhylomeDBi Q8NC06.
TreeFami TF319446.

Miscellaneous databases

EvolutionaryTracei Q8NC06.
GenomeRNAii 79777.
NextBioi 69267.
PROi Q8NC06.

Gene expression databases

ArrayExpressi Q8NC06.
Bgeei Q8NC06.
CleanExi HS_ACBD4.
Genevestigatori Q8NC06.

Family and domain databases

Gene3Di 1.20.80.10. 1 hit.
InterProi IPR022408. Acyl-CoA-binding_prot_CS.
IPR000582. Acyl-CoA-binding_protein.
IPR014352. FERM/acyl-CoA-bd_prot_3-hlx.
[Graphical view ]
Pfami PF00887. ACBP. 1 hit.
[Graphical view ]
PRINTSi PR00689. ACOABINDINGP.
SUPFAMi SSF47027. SSF47027. 1 hit.
PROSITEi PS00880. ACB_1. 1 hit.
PS51228. ACB_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
    Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
    Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Hepatoblastoma.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Ovary and Placenta.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
    Tissue: Brain and Colon.
  5. "Crystal structure of human acyl-CoA binding domain 4."
    Structural genomics consortium (SGC)
    Submitted (APR-2009) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 7-110 IN COMPLEX WITH STEAROYL-COENZYME A.

Entry informationi

Entry nameiACBD4_HUMAN
AccessioniPrimary (citable) accession number: Q8NC06
Secondary accession number(s): D3DX64, Q8IUT1, Q9H8Q4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: June 7, 2005
Last modified: July 9, 2014
This is version 94 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi