Q8NC06 (ACBD4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Acyl-CoA-binding domain-containing protein 4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 268 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Binds medium- and long-chain acyl-CoA esters and may function as an intracellular carrier of acyl-CoA esters. |
| Sequence similarities | Contains 1 ACB (acyl-CoA-binding) domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | Lipid-binding |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Molecular_function | fatty-acyl-CoA binding Inferred from electronic annotation. Source: InterPro lipid bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NC06-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NC06-2) The sequence of this isoform differs from the canonical sequence as follows: 192-268: SSGQHLEESV...SSLTLSVRLE → VWTEQRAASG...LFRMFRTQKR | ||||||
| Isoform 3 (identifier: Q8NC06-3) The sequence of this isoform differs from the canonical sequence as follows: 168-191: ESHSPRDLDSEVFCDSLEQLEPEL → ASLWAVTLPTPPQSPIHPGTWTPRFSVIPWSSWSLSWFGQ 260-268: SLTLSVRLE → RGRSPGPVLGHGPLGSRGPRCSSSSCGPSSSSGSSECFGPKRGDCQWRGLCSQLRLSCCALSLPRV |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||
Molecule processing | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 268 | 268 | Acyl-CoA-binding domain-containing protein 4 | PRO_0000214032 | ||||||||||||||
Regions | ||||||||||||||||||
| Domain | 12 – 101 | 90 | ACB | |||||||||||||||
| Region | 23 – 32 | 10 | Acyl-CoA binding | |||||||||||||||
| Region | 43 – 47 | 5 | Acyl-CoA binding | |||||||||||||||
Sites | ||||||||||||||||||
| Binding site | 69 | 1 | Acyl-CoA | |||||||||||||||
| Binding site | 88 | 1 | Acyl-CoA | |||||||||||||||
Natural variations | ||||||||||||||||||
| Alternative sequence | 168 – 191 | 24 | ESHSP…LEPEL → ASLWAVTLPTPPQSPIHPGT WTPRFSVIPWSSWSLSWFGQ in isoform 3. | VSP_014088 | ||||||||||||||
| Alternative sequence | 192 – 268 | 77 | SSGQH…SVRLE → VWTEQRAASGGKRDPRNSPV PPTKKEGLRGSPPGPQELDV WLLGTVRALQESMQEVQARV QSLESMPRPPEQRPQPRPSA RPWPLGLPGPALLFFLLWPF VVQWLFRMFRTQKR in isoform 2. | VSP_014089 | ||||||||||||||
| Alternative sequence | 260 – 268 | 9 | SLTLSVRLE → RGRSPGPVLGHGPLGSRGPR CSSSSCGPSSSSGSSECFGP KRGDCQWRGLCSQLRLSCCA LSLPRV in isoform 3. | VSP_014090 | ||||||||||||||
| Natural variant | 118 | 1 | P → L. Corresponds to variant rs901754 [ dbSNP | Ensembl ]. | VAR_055478 | ||||||||||||||
| Natural variant | 242 | 1 | R → G. Corresponds to variant rs16939879 [ dbSNP | Ensembl ]. | VAR_059109 | ||||||||||||||
Experimental info | ||||||||||||||||||
| Sequence conflict | 166 | 1 | S → G in BAC11403. Ref.2 | |||||||||||||||
Secondary structure | ||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||
| Helix | 14 – 25 | 12 | ||||||||||||||||
| Helix | 36 – 51 | 16 | ||||||||||||||||
| Helix | 64 – 74 | 11 | ||||||||||||||||
| Turn | 75 – 78 | 4 | ||||||||||||||||
| Helix | 81 – 100 | 20 | ||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas." Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A. Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Hepatoblastoma. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Ovary and Placenta. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). Tissue: Brain and Colon. |
| [5] | "Crystal structure of human acyl-CoA binding domain 4." Structural genomics consortium (SGC) Submitted (APR-2009) to the PDB data bank Cited for: X-RAY CRYSTALLOGRAPHY (2.60 ANGSTROMS) OF 7-110 IN COMPLEX WITH STEAROYL-COENZYME A. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB073387 mRNA. Translation: BAD38638.1. AK023384 mRNA. Translation: BAB14553.1. AK075104 mRNA. Translation: BAC11403.1. CH471178 Genomic DNA. Translation: EAW51550.1. CH471178 Genomic DNA. Translation: EAW51551.1. CH471178 Genomic DNA. Translation: EAW51552.1. BC029164 mRNA. Translation: AAH29164.1. BC041143 mRNA. Translation: AAH41143.1. | ||||||||||||
| IPI | IPI00216847. IPI00419689. IPI00604619. | ||||||||||||
| RefSeq | NP_001129176.1. NM_001135704.1. NP_001129177.1. NM_001135705.1. NP_001129178.1. NM_001135706.1. NP_001129179.1. NM_001135707.1. NP_078998.1. NM_024722.2. | ||||||||||||
| UniGene | Hs.110298. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q8NC06. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | 9606.ENSP00000314440. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q8NC06. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 67460567. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q8NC06. | ||||||||||||
| PRIDE | Q8NC06. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 79777. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000321854; ENSP00000314440; ENSG00000181513. ENST00000376955; ENSP00000366154; ENSG00000181513. ENST00000398322; ENSP00000381367; ENSG00000181513. ENST00000431281; ENSP00000405969; ENSG00000181513. ENST00000586346; ENSP00000465484; ENSG00000181513. ENST00000591859; ENSP00000465610; ENSG00000181513. | ||||||||||||
| GeneID | 79777. | ||||||||||||
| KEGG | hsa:79777. | ||||||||||||
| UCSC | uc002iic.3. human. uc002iid.2. human. uc002iie.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 79777. | ||||||||||||
| GeneCards | GC17P043209. | ||||||||||||
| HGNC | HGNC:23337. ACBD4. | ||||||||||||
| HPA | HPA051772. | ||||||||||||
| neXtProt | NX_Q8NC06. | ||||||||||||
| PharmGKB | PA134897893. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG4281. | ||||||||||||
| HOGENOM | HOG000231479. | ||||||||||||
| HOVERGEN | HBG028530. | ||||||||||||
| OMA | IPWSSWS. | ||||||||||||
Gene expression databases | |||||||||||||
| Bgee | Q8NC06. | ||||||||||||
| CleanEx | HS_ACBD4. | ||||||||||||
| Genevestigator | Q8NC06. | ||||||||||||
| GermOnline | ENSG00000181513. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.20.80.10. 1 hit. | ||||||||||||
| InterPro | IPR022408. Acyl-CoA-binding_prot_CS. IPR000582. Acyl-CoA-binding_protein. IPR014352. FERM/acyl-CoA-bd_prot_3-hlx. [Graphical view] | ||||||||||||
| Pfam | PF00887. ACBP. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00689. ACOABINDINGP. | ||||||||||||
| SUPFAM | SSF47027. ACBP. 1 hit. | ||||||||||||
| PROSITE | PS00880. ACB_1. 1 hit. PS51228. ACB_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q8NC06. | ||||||||||||
| GenomeRNAi | 79777. | ||||||||||||
| NextBio | 69267. | ||||||||||||
Entry information
| Entry name | ACBD4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NC06 Secondary accession number(s): D3DX64, Q8IUT1, Q9H8Q4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
