Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8NBW4

- S38A9_HUMAN

UniProt

Q8NBW4 - S38A9_HUMAN

Protein

Putative sodium-coupled neutral amino acid transporter 9

Gene

SLC38A9

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 90 (01 Oct 2014)
      Sequence version 2 (18 May 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Putative sodium-dependent amino acid/proton antiporter.By similarity

    GO - Biological processi

    1. amino acid transport Source: UniProtKB-KW
    2. sodium ion transport Source: UniProtKB-KW

    Keywords - Biological processi

    Amino-acid transport, Ion transport, Sodium transport, Transport

    Keywords - Ligandi

    Sodium

    Protein family/group databases

    TCDBi2.A.18.9.1. the amino acid/auxin permease (aaap) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Putative sodium-coupled neutral amino acid transporter 9
    Alternative name(s):
    Solute carrier family 38 member 9
    Gene namesi
    Name:SLC38A9
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:26907. SLC38A9.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162403774.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 561561Putative sodium-coupled neutral amino acid transporter 9PRO_0000328840Add
    BLAST

    Proteomic databases

    MaxQBiQ8NBW4.
    PaxDbiQ8NBW4.
    PeptideAtlasiQ0P5S0.
    PRIDEiQ8NBW4.

    PTM databases

    PhosphoSiteiQ8NBW4.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8NBW4.
    BgeeiQ8NBW4.
    CleanExiHS_SLC38A9.
    GenevestigatoriQ8NBW4.

    Organism-specific databases

    HPAiHPA043785.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000316596.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8NBW4.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei120 – 14021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei145 – 16521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei199 – 21921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei291 – 31121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei314 – 33421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei359 – 37921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei393 – 41321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei441 – 46121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei478 – 49821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei510 – 53021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei541 – 56121HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG294315.
    HOGENOMiHOG000294102.
    HOVERGENiHBG106242.
    InParanoidiQ8NBW4.
    KOiK14995.
    OMAiRYSGAAC.
    OrthoDBiEOG7V1FQQ.
    PhylomeDBiQ8NBW4.
    TreeFamiTF312989.

    Family and domain databases

    InterProiIPR013057. AA_transpt_TM.
    [Graphical view]
    PfamiPF01490. Aa_trans. 2 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8NBW4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MANMNSDSRH LGTSEVDHER DPGPMNIQFE PSDLRSKRPF CIEPTNIVNV    50
    NHVIQRVSDH ASAMNKRIHY YSRLTTPADK ALIAPDHVVP APEECYVYSP 100
    LGSAYKLQSY TEGYGKNTSL VTIFMIWNTM MGTSILSIPW GIKQAGFTTG 150
    MCVIILMGLL TLYCCYRVVK SRTMMFSLDT TSWEYPDVCR HYFGSFGQWS 200
    SLLFSLVSLI GAMIVYWVLM SNFLFNTGKF IFNFIHHIND TDTILSTNNS 250
    NPVICPSAGS GGHPDNSSMI FYANDTGAQQ FEKWWDKSRT VPFYLVGLLL 300
    PLLNFKSPSF FSKFNILGTV SVLYLIFLVT FKAVRLGFHL EFHWFIPTEF 350
    FVPEIRFQFP QLTGVLTLAF FIHNCIITLL KNNKKQENNV RDLCIAYMLV 400
    TLTYLYIGVL VFASFPSPPL SKDCIEQNFL DNFPSSDTLS FIARIFLLFQ 450
    MMTVYPLLGY LARVQLLGHI FGDIYPSIFH VLILNLIIVG AGVIMACFYP 500
    NIGGIIRYSG AACGLAFVFI YPSLIYIISL HQEERLTWPK LIFHVFIIIL 550
    GVANLIVQFF M 561
    Length:561
    Mass (Da):63,776
    Last modified:May 18, 2010 - v2
    Checksum:i0C1A3A136158168A
    GO
    Isoform 2 (identifier: Q8NBW4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         428-561: NFLDNFPSSD...VANLIVQFFM → VRHRVPSLCDCVHFHVFIVGRVIQWQDITSDRPGF

    Note: No experimental confirmation available.

    Show »
    Length:462
    Mass (Da):52,717
    Checksum:iFB8344A9CFD7392F
    GO
    Isoform 3 (identifier: Q8NBW4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-37: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSK → MAICILTWRI
         318-353: Missing.

    Show »
    Length:498
    Mass (Da):56,542
    Checksum:iA54A4DA31CC0B696
    GO
    Isoform 4 (identifier: Q8NBW4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-63: Missing.

    Show »
    Length:498
    Mass (Da):56,695
    Checksum:iD213355DA1CD5C13
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti84 – 841A → P in AAH66891. (PubMed:15489334)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti182 – 1821S → T.3 Publications
    Corresponds to variant rs4865615 [ dbSNP | Ensembl ].
    VAR_042546

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6363Missing in isoform 4. 1 PublicationVSP_045110Add
    BLAST
    Alternative sequencei1 – 3737MANMN…DLRSK → MAICILTWRI in isoform 3. 1 PublicationVSP_045111Add
    BLAST
    Alternative sequencei318 – 35336Missing in isoform 3. 1 PublicationVSP_045112Add
    BLAST
    Alternative sequencei428 – 561134NFLDN…VQFFM → VRHRVPSLCDCVHFHVFIVG RVIQWQDITSDRPGF in isoform 2. 1 PublicationVSP_032815Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK075190 mRNA. Translation: BAC11460.1.
    AK127988 mRNA. Translation: BAG54613.1.
    AK301850 mRNA. Translation: BAH13566.1.
    AC008784 Genomic DNA. No translation available.
    AC016632 Genomic DNA. No translation available.
    CH471123 Genomic DNA. Translation: EAW54926.1.
    BC066891 mRNA. Translation: AAH66891.1.
    BC101362 mRNA. Translation: AAI01363.1.
    BX641065 mRNA. Translation: CAE46032.1.
    CCDSiCCDS3968.1. [Q8NBW4-1]
    CCDS58947.1. [Q8NBW4-4]
    CCDS58948.1. [Q8NBW4-3]
    RefSeqiNP_001245215.1. NM_001258286.1. [Q8NBW4-4]
    NP_001245216.1. NM_001258287.1. [Q8NBW4-3]
    NP_775785.2. NM_173514.3. [Q8NBW4-1]
    XP_006714600.1. XM_006714537.1. [Q8NBW4-1]
    XP_006714601.1. XM_006714538.1. [Q8NBW4-1]
    XP_006714602.1. XM_006714539.1. [Q8NBW4-1]
    XP_006714603.1. XM_006714540.1. [Q8NBW4-1]
    UniGeneiHs.745105.

    Genome annotation databases

    EnsembliENST00000318672; ENSP00000316596; ENSG00000177058. [Q8NBW4-1]
    ENST00000396865; ENSP00000380074; ENSG00000177058. [Q8NBW4-1]
    ENST00000512595; ENSP00000427335; ENSG00000177058. [Q8NBW4-3]
    ENST00000515629; ENSP00000420934; ENSG00000177058. [Q8NBW4-4]
    GeneIDi153129.
    KEGGihsa:153129.
    UCSCiuc003jqd.3. human. [Q8NBW4-1]
    uc010ivx.3. human.

    Polymorphism databases

    DMDMi296452888.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK075190 mRNA. Translation: BAC11460.1 .
    AK127988 mRNA. Translation: BAG54613.1 .
    AK301850 mRNA. Translation: BAH13566.1 .
    AC008784 Genomic DNA. No translation available.
    AC016632 Genomic DNA. No translation available.
    CH471123 Genomic DNA. Translation: EAW54926.1 .
    BC066891 mRNA. Translation: AAH66891.1 .
    BC101362 mRNA. Translation: AAI01363.1 .
    BX641065 mRNA. Translation: CAE46032.1 .
    CCDSi CCDS3968.1. [Q8NBW4-1 ]
    CCDS58947.1. [Q8NBW4-4 ]
    CCDS58948.1. [Q8NBW4-3 ]
    RefSeqi NP_001245215.1. NM_001258286.1. [Q8NBW4-4 ]
    NP_001245216.1. NM_001258287.1. [Q8NBW4-3 ]
    NP_775785.2. NM_173514.3. [Q8NBW4-1 ]
    XP_006714600.1. XM_006714537.1. [Q8NBW4-1 ]
    XP_006714601.1. XM_006714538.1. [Q8NBW4-1 ]
    XP_006714602.1. XM_006714539.1. [Q8NBW4-1 ]
    XP_006714603.1. XM_006714540.1. [Q8NBW4-1 ]
    UniGenei Hs.745105.

    3D structure databases

    ProteinModelPortali Q8NBW4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000316596.

    Protein family/group databases

    TCDBi 2.A.18.9.1. the amino acid/auxin permease (aaap) family.

    PTM databases

    PhosphoSitei Q8NBW4.

    Polymorphism databases

    DMDMi 296452888.

    Proteomic databases

    MaxQBi Q8NBW4.
    PaxDbi Q8NBW4.
    PeptideAtlasi Q0P5S0.
    PRIDEi Q8NBW4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000318672 ; ENSP00000316596 ; ENSG00000177058 . [Q8NBW4-1 ]
    ENST00000396865 ; ENSP00000380074 ; ENSG00000177058 . [Q8NBW4-1 ]
    ENST00000512595 ; ENSP00000427335 ; ENSG00000177058 . [Q8NBW4-3 ]
    ENST00000515629 ; ENSP00000420934 ; ENSG00000177058 . [Q8NBW4-4 ]
    GeneIDi 153129.
    KEGGi hsa:153129.
    UCSCi uc003jqd.3. human. [Q8NBW4-1 ]
    uc010ivx.3. human.

    Organism-specific databases

    CTDi 153129.
    GeneCardsi GC05M054958.
    HGNCi HGNC:26907. SLC38A9.
    HPAi HPA043785.
    neXtProti NX_Q8NBW4.
    PharmGKBi PA162403774.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG294315.
    HOGENOMi HOG000294102.
    HOVERGENi HBG106242.
    InParanoidi Q8NBW4.
    KOi K14995.
    OMAi RYSGAAC.
    OrthoDBi EOG7V1FQQ.
    PhylomeDBi Q8NBW4.
    TreeFami TF312989.

    Miscellaneous databases

    GenomeRNAii 153129.
    NextBioi 87078.
    PROi Q8NBW4.

    Gene expression databases

    ArrayExpressi Q8NBW4.
    Bgeei Q8NBW4.
    CleanExi HS_SLC38A9.
    Genevestigatori Q8NBW4.

    Family and domain databases

    InterProi IPR013057. AA_transpt_TM.
    [Graphical view ]
    Pfami PF01490. Aa_trans. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4), VARIANT THR-182.
      Tissue: Placenta and Testis.
    2. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-182.
      Tissue: Testis.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 173-561 (ISOFORM 2), VARIANT THR-182.
      Tissue: Fetal kidney.
    6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiS38A9_HUMAN
    AccessioniPrimary (citable) accession number: Q8NBW4
    Secondary accession number(s): B3KXV1
    , B7Z7D0, Q0P5S0, Q6MZJ8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 8, 2008
    Last sequence update: May 18, 2010
    Last modified: October 1, 2014
    This is version 90 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3