Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8NBW4

- S38A9_HUMAN

UniProt

Q8NBW4 - S38A9_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Putative sodium-coupled neutral amino acid transporter 9

Gene

SLC38A9

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Functioni

Putative sodium-dependent amino acid/proton antiporter.By similarity

GO - Biological processi

  1. amino acid transport Source: UniProtKB-KW
  2. sodium ion transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Amino-acid transport, Ion transport, Sodium transport, Transport

Keywords - Ligandi

Sodium

Protein family/group databases

TCDBi2.A.18.9.1. the amino acid/auxin permease (aaap) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Putative sodium-coupled neutral amino acid transporter 9
Alternative name(s):
Solute carrier family 38 member 9
Gene namesi
Name:SLC38A9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:26907. SLC38A9.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162403774.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 561561Putative sodium-coupled neutral amino acid transporter 9PRO_0000328840Add
BLAST

Proteomic databases

MaxQBiQ8NBW4.
PaxDbiQ8NBW4.
PeptideAtlasiQ0P5S0.
PRIDEiQ8NBW4.

PTM databases

PhosphoSiteiQ8NBW4.

Expressioni

Gene expression databases

BgeeiQ8NBW4.
CleanExiHS_SLC38A9.
ExpressionAtlasiQ8NBW4. baseline and differential.
GenevestigatoriQ8NBW4.

Organism-specific databases

HPAiHPA043785.

Interactioni

Protein-protein interaction databases

BioGridi127480. 8 interactions.
STRINGi9606.ENSP00000316596.

Structurei

3D structure databases

ProteinModelPortaliQ8NBW4.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei120 – 14021HelicalSequence AnalysisAdd
BLAST
Transmembranei145 – 16521HelicalSequence AnalysisAdd
BLAST
Transmembranei199 – 21921HelicalSequence AnalysisAdd
BLAST
Transmembranei291 – 31121HelicalSequence AnalysisAdd
BLAST
Transmembranei314 – 33421HelicalSequence AnalysisAdd
BLAST
Transmembranei359 – 37921HelicalSequence AnalysisAdd
BLAST
Transmembranei393 – 41321HelicalSequence AnalysisAdd
BLAST
Transmembranei441 – 46121HelicalSequence AnalysisAdd
BLAST
Transmembranei478 – 49821HelicalSequence AnalysisAdd
BLAST
Transmembranei510 – 53021HelicalSequence AnalysisAdd
BLAST
Transmembranei541 – 56121HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG294315.
GeneTreeiENSGT00390000005646.
HOGENOMiHOG000294102.
HOVERGENiHBG106242.
InParanoidiQ8NBW4.
KOiK14995.
OMAiRYSGAAC.
OrthoDBiEOG7V1FQQ.
PhylomeDBiQ8NBW4.
TreeFamiTF312989.

Family and domain databases

InterProiIPR013057. AA_transpt_TM.
[Graphical view]
PfamiPF01490. Aa_trans. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8NBW4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MANMNSDSRH LGTSEVDHER DPGPMNIQFE PSDLRSKRPF CIEPTNIVNV
60 70 80 90 100
NHVIQRVSDH ASAMNKRIHY YSRLTTPADK ALIAPDHVVP APEECYVYSP
110 120 130 140 150
LGSAYKLQSY TEGYGKNTSL VTIFMIWNTM MGTSILSIPW GIKQAGFTTG
160 170 180 190 200
MCVIILMGLL TLYCCYRVVK SRTMMFSLDT TSWEYPDVCR HYFGSFGQWS
210 220 230 240 250
SLLFSLVSLI GAMIVYWVLM SNFLFNTGKF IFNFIHHIND TDTILSTNNS
260 270 280 290 300
NPVICPSAGS GGHPDNSSMI FYANDTGAQQ FEKWWDKSRT VPFYLVGLLL
310 320 330 340 350
PLLNFKSPSF FSKFNILGTV SVLYLIFLVT FKAVRLGFHL EFHWFIPTEF
360 370 380 390 400
FVPEIRFQFP QLTGVLTLAF FIHNCIITLL KNNKKQENNV RDLCIAYMLV
410 420 430 440 450
TLTYLYIGVL VFASFPSPPL SKDCIEQNFL DNFPSSDTLS FIARIFLLFQ
460 470 480 490 500
MMTVYPLLGY LARVQLLGHI FGDIYPSIFH VLILNLIIVG AGVIMACFYP
510 520 530 540 550
NIGGIIRYSG AACGLAFVFI YPSLIYIISL HQEERLTWPK LIFHVFIIIL
560
GVANLIVQFF M
Length:561
Mass (Da):63,776
Last modified:May 18, 2010 - v2
Checksum:i0C1A3A136158168A
GO
Isoform 2 (identifier: Q8NBW4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     428-561: NFLDNFPSSD...VANLIVQFFM → VRHRVPSLCDCVHFHVFIVGRVIQWQDITSDRPGF

Note: No experimental confirmation available.

Show »
Length:462
Mass (Da):52,717
Checksum:iFB8344A9CFD7392F
GO
Isoform 3 (identifier: Q8NBW4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSK → MAICILTWRI
     318-353: Missing.

Show »
Length:498
Mass (Da):56,542
Checksum:iA54A4DA31CC0B696
GO
Isoform 4 (identifier: Q8NBW4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: Missing.

Show »
Length:498
Mass (Da):56,695
Checksum:iD213355DA1CD5C13
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti84 – 841A → P in AAH66891. (PubMed:15489334)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti182 – 1821S → T.3 Publications
Corresponds to variant rs4865615 [ dbSNP | Ensembl ].
VAR_042546

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6363Missing in isoform 4. 1 PublicationVSP_045110Add
BLAST
Alternative sequencei1 – 3737MANMN…DLRSK → MAICILTWRI in isoform 3. 1 PublicationVSP_045111Add
BLAST
Alternative sequencei318 – 35336Missing in isoform 3. 1 PublicationVSP_045112Add
BLAST
Alternative sequencei428 – 561134NFLDN…VQFFM → VRHRVPSLCDCVHFHVFIVG RVIQWQDITSDRPGF in isoform 2. 1 PublicationVSP_032815Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK075190 mRNA. Translation: BAC11460.1.
AK127988 mRNA. Translation: BAG54613.1.
AK301850 mRNA. Translation: BAH13566.1.
AC008784 Genomic DNA. No translation available.
AC016632 Genomic DNA. No translation available.
CH471123 Genomic DNA. Translation: EAW54926.1.
BC066891 mRNA. Translation: AAH66891.1.
BC101362 mRNA. Translation: AAI01363.1.
BX641065 mRNA. Translation: CAE46032.1.
CCDSiCCDS3968.1. [Q8NBW4-1]
CCDS58947.1. [Q8NBW4-4]
CCDS58948.1. [Q8NBW4-3]
RefSeqiNP_001245215.1. NM_001258286.1. [Q8NBW4-4]
NP_001245216.1. NM_001258287.1. [Q8NBW4-3]
NP_775785.2. NM_173514.3. [Q8NBW4-1]
XP_006714600.1. XM_006714537.1. [Q8NBW4-1]
XP_006714601.1. XM_006714538.1. [Q8NBW4-1]
XP_006714602.1. XM_006714539.1. [Q8NBW4-1]
XP_006714603.1. XM_006714540.1. [Q8NBW4-1]
UniGeneiHs.745105.

Genome annotation databases

EnsembliENST00000318672; ENSP00000316596; ENSG00000177058. [Q8NBW4-1]
ENST00000396865; ENSP00000380074; ENSG00000177058. [Q8NBW4-1]
ENST00000512595; ENSP00000427335; ENSG00000177058. [Q8NBW4-3]
ENST00000515629; ENSP00000420934; ENSG00000177058. [Q8NBW4-4]
GeneIDi153129.
KEGGihsa:153129.
UCSCiuc003jqd.3. human. [Q8NBW4-1]
uc010ivx.3. human.

Polymorphism databases

DMDMi296452888.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK075190 mRNA. Translation: BAC11460.1 .
AK127988 mRNA. Translation: BAG54613.1 .
AK301850 mRNA. Translation: BAH13566.1 .
AC008784 Genomic DNA. No translation available.
AC016632 Genomic DNA. No translation available.
CH471123 Genomic DNA. Translation: EAW54926.1 .
BC066891 mRNA. Translation: AAH66891.1 .
BC101362 mRNA. Translation: AAI01363.1 .
BX641065 mRNA. Translation: CAE46032.1 .
CCDSi CCDS3968.1. [Q8NBW4-1 ]
CCDS58947.1. [Q8NBW4-4 ]
CCDS58948.1. [Q8NBW4-3 ]
RefSeqi NP_001245215.1. NM_001258286.1. [Q8NBW4-4 ]
NP_001245216.1. NM_001258287.1. [Q8NBW4-3 ]
NP_775785.2. NM_173514.3. [Q8NBW4-1 ]
XP_006714600.1. XM_006714537.1. [Q8NBW4-1 ]
XP_006714601.1. XM_006714538.1. [Q8NBW4-1 ]
XP_006714602.1. XM_006714539.1. [Q8NBW4-1 ]
XP_006714603.1. XM_006714540.1. [Q8NBW4-1 ]
UniGenei Hs.745105.

3D structure databases

ProteinModelPortali Q8NBW4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127480. 8 interactions.
STRINGi 9606.ENSP00000316596.

Protein family/group databases

TCDBi 2.A.18.9.1. the amino acid/auxin permease (aaap) family.

PTM databases

PhosphoSitei Q8NBW4.

Polymorphism databases

DMDMi 296452888.

Proteomic databases

MaxQBi Q8NBW4.
PaxDbi Q8NBW4.
PeptideAtlasi Q0P5S0.
PRIDEi Q8NBW4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000318672 ; ENSP00000316596 ; ENSG00000177058 . [Q8NBW4-1 ]
ENST00000396865 ; ENSP00000380074 ; ENSG00000177058 . [Q8NBW4-1 ]
ENST00000512595 ; ENSP00000427335 ; ENSG00000177058 . [Q8NBW4-3 ]
ENST00000515629 ; ENSP00000420934 ; ENSG00000177058 . [Q8NBW4-4 ]
GeneIDi 153129.
KEGGi hsa:153129.
UCSCi uc003jqd.3. human. [Q8NBW4-1 ]
uc010ivx.3. human.

Organism-specific databases

CTDi 153129.
GeneCardsi GC05M054958.
HGNCi HGNC:26907. SLC38A9.
HPAi HPA043785.
neXtProti NX_Q8NBW4.
PharmGKBi PA162403774.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG294315.
GeneTreei ENSGT00390000005646.
HOGENOMi HOG000294102.
HOVERGENi HBG106242.
InParanoidi Q8NBW4.
KOi K14995.
OMAi RYSGAAC.
OrthoDBi EOG7V1FQQ.
PhylomeDBi Q8NBW4.
TreeFami TF312989.

Miscellaneous databases

GenomeRNAii 153129.
NextBioi 87078.
PROi Q8NBW4.

Gene expression databases

Bgeei Q8NBW4.
CleanExi HS_SLC38A9.
ExpressionAtlasi Q8NBW4. baseline and differential.
Genevestigatori Q8NBW4.

Family and domain databases

InterProi IPR013057. AA_transpt_TM.
[Graphical view ]
Pfami PF01490. Aa_trans. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4), VARIANT THR-182.
    Tissue: Placenta and Testis.
  2. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-182.
    Tissue: Testis.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 173-561 (ISOFORM 2), VARIANT THR-182.
    Tissue: Fetal kidney.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiS38A9_HUMAN
AccessioniPrimary (citable) accession number: Q8NBW4
Secondary accession number(s): B3KXV1
, B7Z7D0, Q0P5S0, Q6MZJ8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 18, 2010
Last modified: October 29, 2014
This is version 91 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3