Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8NBW4 (S38A9_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 89. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Putative sodium-coupled neutral amino acid transporter 9
Alternative name(s):
Solute carrier family 38 member 9
Gene names
Name:SLC38A9
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length561 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Putative sodium-dependent amino acid/proton antiporter By similarity.

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Sequence similarities

Belongs to the amino acid/polyamine transporter 2 family.

Ontologies

Keywords
   Biological processAmino-acid transport
Ion transport
Sodium transport
Transport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   LigandSodium
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processamino acid transport

Inferred from electronic annotation. Source: UniProtKB-KW

sodium ion transport

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8NBW4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8NBW4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     428-561: NFLDNFPSSD...VANLIVQFFM → VRHRVPSLCDCVHFHVFIVGRVIQWQDITSDRPGF
Note: No experimental confirmation available.
Isoform 3 (identifier: Q8NBW4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSK → MAICILTWRI
     318-353: Missing.
Isoform 4 (identifier: Q8NBW4-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 561561Putative sodium-coupled neutral amino acid transporter 9
PRO_0000328840

Regions

Transmembrane120 – 14021Helical; Potential
Transmembrane145 – 16521Helical; Potential
Transmembrane199 – 21921Helical; Potential
Transmembrane291 – 31121Helical; Potential
Transmembrane314 – 33421Helical; Potential
Transmembrane359 – 37921Helical; Potential
Transmembrane393 – 41321Helical; Potential
Transmembrane441 – 46121Helical; Potential
Transmembrane478 – 49821Helical; Potential
Transmembrane510 – 53021Helical; Potential
Transmembrane541 – 56121Helical; Potential

Natural variations

Alternative sequence1 – 6363Missing in isoform 4.
VSP_045110
Alternative sequence1 – 3737MANMN…DLRSK → MAICILTWRI in isoform 3.
VSP_045111
Alternative sequence318 – 35336Missing in isoform 3.
VSP_045112
Alternative sequence428 – 561134NFLDN…VQFFM → VRHRVPSLCDCVHFHVFIVG RVIQWQDITSDRPGF in isoform 2.
VSP_032815
Natural variant1821S → T. Ref.1 Ref.4 Ref.5
Corresponds to variant rs4865615 [ dbSNP | Ensembl ].
VAR_042546

Experimental info

Sequence conflict841A → P in AAH66891. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 18, 2010. Version 2.
Checksum: 0C1A3A136158168A

FASTA56163,776
        10         20         30         40         50         60 
MANMNSDSRH LGTSEVDHER DPGPMNIQFE PSDLRSKRPF CIEPTNIVNV NHVIQRVSDH 

        70         80         90        100        110        120 
ASAMNKRIHY YSRLTTPADK ALIAPDHVVP APEECYVYSP LGSAYKLQSY TEGYGKNTSL 

       130        140        150        160        170        180 
VTIFMIWNTM MGTSILSIPW GIKQAGFTTG MCVIILMGLL TLYCCYRVVK SRTMMFSLDT 

       190        200        210        220        230        240 
TSWEYPDVCR HYFGSFGQWS SLLFSLVSLI GAMIVYWVLM SNFLFNTGKF IFNFIHHIND 

       250        260        270        280        290        300 
TDTILSTNNS NPVICPSAGS GGHPDNSSMI FYANDTGAQQ FEKWWDKSRT VPFYLVGLLL 

       310        320        330        340        350        360 
PLLNFKSPSF FSKFNILGTV SVLYLIFLVT FKAVRLGFHL EFHWFIPTEF FVPEIRFQFP 

       370        380        390        400        410        420 
QLTGVLTLAF FIHNCIITLL KNNKKQENNV RDLCIAYMLV TLTYLYIGVL VFASFPSPPL 

       430        440        450        460        470        480 
SKDCIEQNFL DNFPSSDTLS FIARIFLLFQ MMTVYPLLGY LARVQLLGHI FGDIYPSIFH 

       490        500        510        520        530        540 
VLILNLIIVG AGVIMACFYP NIGGIIRYSG AACGLAFVFI YPSLIYIISL HQEERLTWPK 

       550        560 
LIFHVFIIIL GVANLIVQFF M 

« Hide

Isoform 2 [UniParc].

Checksum: FB8344A9CFD7392F
Show »

FASTA46252,717
Isoform 3 [UniParc].

Checksum: A54A4DA31CC0B696
Show »

FASTA49856,542
Isoform 4 [UniParc].

Checksum: D213355DA1CD5C13
Show »

FASTA49856,695

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4), VARIANT THR-182.
Tissue: Placenta and Testis.
[2]"The DNA sequence and comparative analysis of human chromosome 5."
Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. expand/collapse author list , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-182.
Tissue: Testis.
[5]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 173-561 (ISOFORM 2), VARIANT THR-182.
Tissue: Fetal kidney.
[6]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK075190 mRNA. Translation: BAC11460.1.
AK127988 mRNA. Translation: BAG54613.1.
AK301850 mRNA. Translation: BAH13566.1.
AC008784 Genomic DNA. No translation available.
AC016632 Genomic DNA. No translation available.
CH471123 Genomic DNA. Translation: EAW54926.1.
BC066891 mRNA. Translation: AAH66891.1.
BC101362 mRNA. Translation: AAI01363.1.
BX641065 mRNA. Translation: CAE46032.1.
CCDSCCDS3968.1. [Q8NBW4-1]
CCDS58947.1. [Q8NBW4-4]
CCDS58948.1. [Q8NBW4-3]
RefSeqNP_001245215.1. NM_001258286.1. [Q8NBW4-4]
NP_001245216.1. NM_001258287.1. [Q8NBW4-3]
NP_775785.2. NM_173514.3. [Q8NBW4-1]
XP_006714600.1. XM_006714537.1. [Q8NBW4-1]
XP_006714601.1. XM_006714538.1. [Q8NBW4-1]
XP_006714602.1. XM_006714539.1. [Q8NBW4-1]
XP_006714603.1. XM_006714540.1. [Q8NBW4-1]
UniGeneHs.745105.

3D structure databases

ProteinModelPortalQ8NBW4.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000316596.

Protein family/group databases

TCDB2.A.18.9.1. the amino acid/auxin permease (aaap) family.

PTM databases

PhosphoSiteQ8NBW4.

Polymorphism databases

DMDM296452888.

Proteomic databases

MaxQBQ8NBW4.
PaxDbQ8NBW4.
PeptideAtlasQ0P5S0.
PRIDEQ8NBW4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000318672; ENSP00000316596; ENSG00000177058. [Q8NBW4-1]
ENST00000396865; ENSP00000380074; ENSG00000177058. [Q8NBW4-1]
ENST00000512595; ENSP00000427335; ENSG00000177058. [Q8NBW4-3]
ENST00000515629; ENSP00000420934; ENSG00000177058. [Q8NBW4-4]
ENST00000539768; ENSP00000437771; ENSG00000177058. [Q8NBW4-2]
GeneID153129.
KEGGhsa:153129.
UCSCuc003jqd.3. human. [Q8NBW4-1]
uc010ivx.3. human.

Organism-specific databases

CTD153129.
GeneCardsGC05M054958.
HGNCHGNC:26907. SLC38A9.
HPAHPA043785.
neXtProtNX_Q8NBW4.
PharmGKBPA162403774.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG294315.
HOGENOMHOG000294102.
HOVERGENHBG106242.
InParanoidQ8NBW4.
KOK14995.
OMARYSGAAC.
OrthoDBEOG7V1FQQ.
PhylomeDBQ8NBW4.
TreeFamTF312989.

Gene expression databases

ArrayExpressQ8NBW4.
BgeeQ8NBW4.
CleanExHS_SLC38A9.
GenevestigatorQ8NBW4.

Family and domain databases

InterProIPR013057. AA_transpt_TM.
[Graphical view]
PfamPF01490. Aa_trans. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi153129.
NextBio87078.
PROQ8NBW4.

Entry information

Entry nameS38A9_HUMAN
AccessionPrimary (citable) accession number: Q8NBW4
Secondary accession number(s): B3KXV1 expand/collapse secondary AC list , B7Z7D0, Q0P5S0, Q6MZJ8
Entry history
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: May 18, 2010
Last modified: July 9, 2014
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM