Q8NBW4 (S38A9_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Putative sodium-coupled neutral amino acid transporter 9 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 561 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Putative sodium-dependent amino acid/proton antiporter By similarity. |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | Belongs to the amino acid/polyamine transporter 2 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Amino-acid transport Ion transport Sodium transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Sodium |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | amino acid transport Inferred from electronic annotation. Source: UniProtKB-KW sodium ion transportInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NBW4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NBW4-2) The sequence of this isoform differs from the canonical sequence as follows: 428-561: NFLDNFPSSD...VANLIVQFFM → VRHRVPSLCDCVHFHVFIVGRVIQWQDITSDRPGF | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8NBW4-3) The sequence of this isoform differs from the canonical sequence as follows: 1-37: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSK → MAICILTWRI 318-353: Missing. | ||||||
| Isoform 4 (identifier: Q8NBW4-4) The sequence of this isoform differs from the canonical sequence as follows: 1-63: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 561 | 561 | Putative sodium-coupled neutral amino acid transporter 9 | PRO_0000328840 | |||||
Regions | |||||||||
| Transmembrane | 120 – 140 | 21 | Helical; Potential | ||||||
| Transmembrane | 145 – 165 | 21 | Helical; Potential | ||||||
| Transmembrane | 199 – 219 | 21 | Helical; Potential | ||||||
| Transmembrane | 291 – 311 | 21 | Helical; Potential | ||||||
| Transmembrane | 314 – 334 | 21 | Helical; Potential | ||||||
| Transmembrane | 359 – 379 | 21 | Helical; Potential | ||||||
| Transmembrane | 393 – 413 | 21 | Helical; Potential | ||||||
| Transmembrane | 441 – 461 | 21 | Helical; Potential | ||||||
| Transmembrane | 478 – 498 | 21 | Helical; Potential | ||||||
| Transmembrane | 510 – 530 | 21 | Helical; Potential | ||||||
| Transmembrane | 541 – 561 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 63 | 63 | Missing in isoform 4. | VSP_045110 | |||||
| Alternative sequence | 1 – 37 | 37 | MANMN…DLRSK → MAICILTWRI in isoform 3. | VSP_045111 | |||||
| Alternative sequence | 318 – 353 | 36 | Missing in isoform 3. | VSP_045112 | |||||
| Alternative sequence | 428 – 561 | 134 | NFLDN…VQFFM → VRHRVPSLCDCVHFHVFIVG RVIQWQDITSDRPGF in isoform 2. | VSP_032815 | |||||
| Natural variant | 182 | 1 | S → T. Ref.1 Ref.4 Ref.5 Corresponds to variant rs4865615 [ dbSNP | Ensembl ]. | VAR_042546 | |||||
Experimental info | |||||||||
| Sequence conflict | 84 | 1 | A → P in AAH66891. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK075190 mRNA. Translation: BAC11460.1. AK127988 mRNA. Translation: BAG54613.1. AK301850 mRNA. Translation: BAH13566.1. AC008784 Genomic DNA. No translation available. AC016632 Genomic DNA. No translation available. CH471123 Genomic DNA. Translation: EAW54926.1. BC066891 mRNA. Translation: AAH66891.1. BC101362 mRNA. Translation: AAI01363.1. BX641065 mRNA. Translation: CAE46032.1. |
| IPI | IPI00168340. IPI00889635. |
| RefSeq | NP_001245215.1. NM_001258286.1. NP_001245216.1. NM_001258287.1. NP_775785.2. NM_173514.3. |
| UniGene | Hs.649685. |
3D structure databases | |
| ProteinModelPortal | Q8NBW4. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000316596. |
Protein family/group databases | |
| TCDB | 2.A.18.9.1. amino acid/auxin permease (AAAP) family. |
PTM databases | |
| PhosphoSite | Q8NBW4. |
Polymorphism databases | |
| DMDM | 296452888. |
Proteomic databases | |
| PaxDb | Q8NBW4. |
| PeptideAtlas | Q0P5S0. |
| PRIDE | Q8NBW4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000318672; ENSP00000316596; ENSG00000177058. ENST00000396865; ENSP00000380074; ENSG00000177058. ENST00000512595; ENSP00000427335; ENSG00000177058. ENST00000515629; ENSP00000420934; ENSG00000177058. ENST00000539768; ENSP00000437771; ENSG00000177058. |
| GeneID | 153129. |
| KEGG | hsa:153129. |
| UCSC | uc003jqd.2. human. uc010ivx.2. human. |
Organism-specific databases | |
| CTD | 153129. |
| GeneCards | GC05M054958. |
| HGNC | HGNC:26907. SLC38A9. |
| HPA | HPA043785. |
| neXtProt | NX_Q8NBW4. |
| PharmGKB | PA162403774. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG294315. |
| HOGENOM | HOG000294102. |
| HOVERGEN | HBG106242. |
| InParanoid | Q8NBW4. |
| KO | K14995. |
| OMA | RYSGAAC. |
| OrthoDB | EOG469QTD. |
| PhylomeDB | Q8NBW4. |
Gene expression databases | |
| ArrayExpress | Q8NBW4. |
| Bgee | Q8NBW4. |
| CleanEx | HS_SLC38A9. |
| Genevestigator | Q8NBW4. |
Family and domain databases | |
| InterPro | IPR013057. AA_transpt_TM. [Graphical view] |
| Pfam | PF01490. Aa_trans. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 153129. |
| NextBio | 87078. |
Entry information
| Entry name | S38A9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NBW4 Secondary accession number(s): B3KXV1 Q6MZJ8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
