Reviewed,
UniProtKB/Swiss-Prot Q8NBK3 (SUMF1_HUMAN)
Last modified
June 16, 2009.
Version 72.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Sulfatase-modifying factor 1 EC=1.8.99.- Alternative name(s): C-alpha-formylglycine-generating enzyme 1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 374 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Using molecular oxygen and an unidentified reducing agent, oxidizes a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also called C(alpha)-formylglycine. Known substrates include GALNS, ARSA, STS and ARSE. Ref.2 Ref.8 |
| Catalytic activity | [sulfatase]-cysteine + acceptor = [sulfatase]-3-oxoalanine + reduced acceptor. |
| Pathway | |
| Subunit structure | Monomer, homodimer and heterodimer with SUMF2. Ref.7 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Highly expressed in kidney, pancreas and liver. Detected at lower levels in leukocytes, lung, placenta, small intestine, skeletal muscle and heart. Ref.7 |
| Post-translational modification | N-glycosylated. Contains high-mannose-type oligosaccharides. Ref.8 Ref.9 |
| Involvement in disease | Defects in SUMF1 are the cause of multiple sulfatase deficiency (MSD) [MIM:272200]. MSD is a clinically and biochemically heterogeneous disorder caused by the simultaneous impairment of all sulfatases, due to defective post-translational modification and activation. It combines features of individual sulfatase deficiencies such as metachromatic leukodystrophy, mucopolysaccharidosis, chondrodysplasia punctata, hydrocephalus, ichthyosis, neurologic deterioration and developmental delay. Inheritance is autosomal recessive. Ref.2 Ref.1 Ref.12 Ref.13 |
| Miscellaneous | The resulting 3-oxoalanine in the substrate protein is called C(alpha)-formylglycine by many authors. It should not be confused with N-formylglycine. |
| Sequence similarities | Belongs to the sulfatase-modifying factor family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Endoplasmic reticulum |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation Ichthyosis Leukodystrophy Metachromatic leukodystrophy Mucopolysaccharidosis |
| Domain | Redox-active center Signal |
| Ligand | Calcium Metal-binding |
| Molecular function | Oxidoreductase |
| PTM | Disulfide bond Glycoprotein |
| Technical term | 3D-structure Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | glycosaminoglycan metabolic process Inferred from electronic annotation. Source: UniProtKB-KW oxidation reductionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | endoplasmic reticulum Inferred from electronic annotation. Source: UniProtKB-KW endoplasmic reticulum lumenInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | calcium ion binding Inferred from electronic annotation. Source: UniProtKB-KW oxidoreductase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8NBK3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8NBK3-2) The sequence of this isoform differs from the canonical sequence as follows: 1-90: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8NBK3-3) The sequence of this isoform differs from the canonical sequence as follows: 340-374: YCYRYRCAARSQNTPDSSASNLGFRCAADRLPTMD → QEYYDPYFQD...QHGPRLHCVD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 33 | 33 | ||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 34 – 374 | 341 | Sulfatase-modifying factor 1 | PRO_0000033456 | ||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 341 – 360 | 20 | Interaction with sulfatases | |||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 333 | 1 | Proton acceptor Probable | |||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 130 | 1 | Calcium 2 | |||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 259 | 1 | Calcium 1 | |||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 260 | 1 | Calcium 1; via carbonyl oxygen | |||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 273 | 1 | Calcium 1 | |||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 275 | 1 | Calcium 1; via carbonyl oxygen | |||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 293 | 1 | Calcium 2; via carbonyl oxygen | |||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 296 | 1 | Calcium 2; via carbonyl oxygen | |||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 298 | 1 | Calcium 2; via carbonyl oxygen | |||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 300 | 1 | Calcium 2 | |||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 141 | 1 | N-linked (GlcNAc...) Ref.8 Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 50 ↔ 52 | Ref.8 Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 218 ↔ 365 | Ref.8 Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 235 ↔ 346 | Ref.8 Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 336 ↔ 341 | Redox-active Ref.8 Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 90 | 90 | Missing in isoform 2. | VSP_007877 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 340 – 374 | 35 | YCYRY…LPTMD → QEYYDPYFQDVASEMLRRHT ASRWKAFSSLEPCCSIRRHQ QYAAIERLTCGKFELRCASL RKIDCLNTNIACSYSMRQHG PRLHCVD in isoform 3. | VSP_013185 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 20 | 1 | L → F in MSD; loss of activity. Ref.12 | VAR_019050 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 63 | 1 | S → N: dbSNP rs2819590. Ref.1 Ref.3 | VAR_016052 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 155 | 1 | S → P in MSD; loss of activity. Ref.2 Ref.12 | VAR_016053 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 177 | 1 | A → P in MSD; loss of activity; decreases its specific enzyme activity to less than 1%; does not affect localization of the protein in the endoplasmic reticulum of MSD fibroblasts; protein stability is almost comparable to wild-type. Ref.12 Ref.13 | VAR_019051 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 179 | 1 | W → S in MSD; decreases its specific enzyme activity to less than 3%; does not affect localization of the protein in the endoplasmic reticulum of MSD fibroblasts; protein stability is almost comparable to wild-type. Ref.13 | VAR_042602 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 218 | 1 | C → Y in MSD; loss of activity. Ref.2 Ref.12 | VAR_016054 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 224 | 1 | R → W in MSD; loss of activity. Ref.12 | VAR_019052 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 259 | 1 | N → I in MSD; loss of activity. Ref.12 | VAR_019053 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 266 | 1 | P → L in MSD; retains some activity. Ref.12 | VAR_019054 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 279 | 1 | A → V in MSD; loss of activity; decreases its specific enzyme activity to about 23%; does not affect localization of the protein in the endoplasmic reticulum of MSD fibroblasts; protein stability is decreased. Ref.1 Ref.12 Ref.13 | VAR_016055 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 336 | 1 | C → R in MSD; loss of activity. Ref.2 Ref.1 Ref.12 | VAR_016056 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 345 | 1 | R → C in MSD; retains some activity. Ref.2 Ref.12 | VAR_016057 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 348 | 1 | A → P in MSD; loss of activity. Ref.2 Ref.12 | VAR_016058 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 349 | 1 | R → Q in MSD; loss of activity. Ref.2 Ref.1 Ref.12 Ref.13 | VAR_016059 | ||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 349 | 1 | R → W in MSD; loss of activity; decreases its specific enzyme activity to less than 1%; does not affect localization of the protein in the endoplasmic reticulum of MSD fibroblasts; protein stability is severely decreased. Ref.2 Ref.1 Ref.12 Ref.13 | VAR_016060 | ||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 333 | 1 | S → A: Loss of activity. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 333 | 1 | S → T: Reduces activity by 99%. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 336 | 1 | C → S: Loss of activity. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 337 | 1 | H → A: Reduces activity 5-fold. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 340 | 1 | Y → F: No effect. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 341 | 1 | C → S: Loss of activity. Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 124 | 1 | F → L in BAC11634. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 264 | 1 | E → D in BAC11634. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 91 – 94 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 97 – 102 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 109 – 111 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 117 – 121 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 124 – 129 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 133 – 143 | 11 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 148 – 152 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 154 – 158 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 159 – 161 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 180 – 184 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 211 – 220 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 228 – 236 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 252 – 254 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 265 – 267 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 293 – 305 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 315 – 317 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 325 – 331 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 338 – 340 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 350 – 352 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 366 – 369 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Multiple sulfatase deficiency is caused by mutations in the gene encoding the Homo sapiens C-alpha-formyglycine-generating enzyme." Dierks T., Schmidt B., Borissenko L.V., Peng J., Preusser A., Mariappan M., von Figura K. Cell 113:435-444(2003) [PubMed: 12757705] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS MSD VAL-279; ARG-336; GLN-349 AND TRP-349, VARIANT ASN-63. |
| [2] | "The multiple sulfatase deficiency gene encodes an essential and limiting factor for the activity of sulfatases." Cosma M.P., Pepe S., Annunziata I., Newbold R.F., Grompe M., Parenti G., Ballabio A. Cell 113:445-456(2003) [PubMed: 12757706] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS MSD PRO-155; TYR-218; ARG-336; CYS-345; PRO-348; GLN-349 AND TRP-349, FUNCTION. |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT ASN-63. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Gastric mucosa. |
| [5] | "HRI human cDNA sequencing project." Ota T., Nishikawa T., Suzuki Y., Kawai-Hio Y., Hayashi K., Ishii S., Saito K., Yamamoto J., Wakamatsu A., Nagai T., Nakamura Y., Nagahari K., Sugano S., Isogai T. Submitted (MAR-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Placenta. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Colon and Prostate. |
| [7] | "Sulphatase activities are regulated by the interaction of sulphatase-modifying factor 1 with SUMF2." Zito E., Fraldi A., Pepe S., Annunziata I., Kobinger G., Di Natale P., Ballabio A., Cosma M.P. EMBO Rep. 6:655-660(2005) [PubMed: 15962010] [Abstract] Cited for: SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [8] | "Molecular characterization of the human Calpha-formylglycine-generating enzyme." Preusser-Kunze A., Mariappan M., Schmidt B., Gande S.L., Mutenda K., Wenzel D., von Figura K., Dierks T. J. Biol. Chem. 280:14900-14910(2005) [PubMed: 15657036] [Abstract] Cited for: PROTEIN SEQUENCE OF N-TERMINUS, FUNCTION, MASS SPECTROMETRY, CALCIUM-BINDING, GLYCOSYLATION AT ASN-141, SUBCELLULAR LOCATION, DISULFIDE BONDS. |
| [9] | "Molecular basis for multiple sulfatase deficiency and mechanism for formylglycine generation of the human formylglycine-generating enzyme." Dierks T., Dickmanns A., Preusser-Kunze A., Schmidt B., Mariappan M., von Figura K., Ficner R., Rudolph M.G. Cell 121:541-552(2005) [PubMed: 15907468] [Abstract] Cited for: PARTIAL PROTEIN SEQUENCE, X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 73-374 IN COMPLEX WITH CALCIUM, GLYCOSYLATION AT ASN-141, MUTAGENESIS OF SER-333; CYS-336; HIS-337; TYR-340 AND CYS-341, DISULFIDE BONDS. |
| [10] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-141, MASS SPECTROMETRY. Tissue: Liver. |
| [11] | "A general binding mechanism for all human sulfatases by the formylglycine-generating enzyme." Roeser D., Preusser-Kunze A., Schmidt B., Gasow K., Wittmann J.G., Dierks T., von Figura K., Rudolph M.G. Proc. Natl. Acad. Sci. U.S.A. 103:81-86(2006) [PubMed: 16368756] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.48 ANGSTROMS) OF MUTANTS SER-336 AND SER-341 IN COMPLEX WITH SULFATASE PEPTIDE. |
| [12] | "Molecular and functional analysis of SUMF1 mutations in multiple sulfatase deficiency." Cosma M.P., Pepe S., Parenti G., Settembre C., Annunziata I., Wade-Martins R., Domenico C.D., Natale P.D., Mankad A., Cox B., Uziel G., Mancini G.M., Zammarchi E., Donati M.A., Kleijer W.J., Filocamo M., Carrozzo R., Carella M., Ballabio A. Hum. Mutat. 23:576-581(2004) [PubMed: 15146462] [Abstract] Cited for: VARIANTS MSD PHE-20; PRO-177; TRP-224; ILE-259 AND LEU-266, CHARACTERIZATION OF VARIANTS MSD PHE-20; PRO-155; PRO-177; TYR-218; TRP-224; ILE-259; LEU-266; VAL-279; ARG-336; CYS-345; PRO-348; TRP-349 AND GLN-349. |
| [13] | "Molecular analysis of SUMF1 mutations: stability and residual activity of mutant formylglycine-generating enzyme determine disease severity in multiple sulfatase deficiency." Schlotawa L., Steinfeld R., von Figura K., Dierks T., Gaertner J. Hum. Mutat. 29:205-205(2008) [PubMed: 18157819] [Abstract] Cited for: CHARACTERIZATION OF VARIANTS MSD PRO-177; SER-179; VAL-279 AND TRP-349. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AY208752 mRNA. Translation: AAO34683.1. AY323910 mRNA. Translation: AAP86217.1. AY358092 mRNA. Translation: AAQ88459.1. AK057983 mRNA. Translation: BAB71625.1. AK075459 mRNA. Translation: BAC11634.1. BC017005 mRNA. Translation: AAH17005.2. BC110862 mRNA. Translation: AAI10863.1. BC121122 mRNA. Translation: AAI21123.1. | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00301144. IPI00332413. IPI00432718. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_877437.2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.588682 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q8NBK3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENSG00000144455. Homo sapiens. [Contig view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 285362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:285362. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC03M003844. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| H-InvDB | HIX0003013. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:20376. SUMF1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 272200. phenotype. 607939. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Orphanet | 585. Mucosulfatidosis. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA134977552. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | Q8NBK3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q8NBK3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q8NBK3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SUMF1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000144455. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR005532. Sulphatase-mod_factor. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:3.90.1580.10. SO4-mod_fac-like. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF03781. DUF323. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 95470. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SUMF1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8NBK3 Secondary accession number(s): Q0VAC7 Q96DK8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


