Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 511

Gene

ZNF511

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri80 – 105C2H2-type 1Add BLAST26
Zinc fingeri107 – 130C2H2-type 2Add BLAST24
Zinc fingeri144 – 169C2H2-type 3Add BLAST26

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 511
Gene namesi
Name:ZNF511
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000198546.14
HGNCiHGNC:28445 ZNF511
neXtProtiNX_Q8NB15

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000198546
PharmGKBiPA134940031

Polymorphism and mutation databases

BioMutaiZNF511
DMDMi74760090

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000476291 – 262Zinc finger protein 511Add BLAST262

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q8NB15-2)
Modified residuei240Omega-N-methylarginineCombined sources1

Keywords - PTMi

Methylation

Proteomic databases

MaxQBiQ8NB15
PaxDbiQ8NB15
PeptideAtlasiQ8NB15
PRIDEiQ8NB15

PTM databases

iPTMnetiQ8NB15
PhosphoSitePlusiQ8NB15

Expressioni

Gene expression databases

BgeeiENSG00000198546
CleanExiHS_ZNF511
GenevisibleiQ8NB15 HS

Organism-specific databases

HPAiHPA035360

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ISL1P613713EBI-10269136,EBI-3906896

Protein-protein interaction databases

BioGridi125611, 16 interactors
IntActiQ8NB15, 6 interactors
STRINGi9606.ENSP00000355251

Structurei

3D structure databases

ProteinModelPortaliQ8NB15
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri80 – 105C2H2-type 1Add BLAST26
Zinc fingeri107 – 130C2H2-type 2Add BLAST24
Zinc fingeri144 – 169C2H2-type 3Add BLAST26

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG4173 Eukaryota
ENOG4111TX5 LUCA
GeneTreeiENSGT00390000011381
HOGENOMiHOG000013167
HOVERGENiHBG094183
InParanoidiQ8NB15
OMAiCPIVGCG
OrthoDBiEOG091G0JFZ
PhylomeDBiQ8NB15
TreeFamiTF323277

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 3 hits
SUPFAMiSSF57667 SSF57667, 1 hit
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NB15-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQLPPALCAR LAAGPGAAEP LPVERDPAAG AAPFRFVARP VRFPREHQFF
60 70 80 90 100
EDGDVQRHLY LQDVIMQVAD VPEKPRVPAF ACQVAGCCQV FDALDDYEHH
110 120 130 140 150
YHTLHGNVCS FCKRAFPSGH LLDAHILEWH DSLFQILSER QDMYQCLVEG
160 170 180 190 200
CTEKFKTSRD RKDHMVRMHL YPADFRFDKP KKSRSPASAE APGDSGERSE
210 220 230 240 250
GEAMEICSEP VAASPAPAGE RRIYRHRSVS ELFLKPVLNM CSVLRILGCT
260
WAAALLILNS ER
Length:262
Mass (Da):29,428
Last modified:October 1, 2002 - v1
Checksum:iCDBA5CD0F34EC26D
GO
Isoform 2 (identifier: Q8NB15-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     228-262: SVSELFLKPVLNMCSVLRILGCTWAAALLILNSER → IPSTICFGQGAARGFKSNKKKTKQC

Note: No experimental confirmation available.Combined sources
Show »
Length:252
Mass (Da):28,265
Checksum:i06EB73C722D8BA33
GO

Sequence cautioni

The sequence AAH15139 differs from that shown. Reason: Erroneous initiation.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_016035228 – 262SVSEL…LNSER → IPSTICFGQGAARGFKSNKK KTKQC in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091711 mRNA Translation: BAC03729.1
AK292380 mRNA Translation: BAF85069.1
AL360181 Genomic DNA No translation available.
CH471211 Genomic DNA Translation: EAW61333.1
BC015139 mRNA Translation: AAH15139.1 Different initiation.
BC019897 mRNA Translation: AAH19897.1
CCDSiCCDS7677.1 [Q8NB15-2]
RefSeqiNP_665805.2, NM_145806.3 [Q8NB15-2]
UniGeneiHs.422113

Genome annotation databases

EnsembliENST00000359035; ENSP00000351929; ENSG00000198546 [Q8NB15-1]
ENST00000361518; ENSP00000355251; ENSG00000198546 [Q8NB15-2]
GeneIDi118472
KEGGihsa:118472
UCSCiuc001lmj.2 human [Q8NB15-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiZN511_HUMAN
AccessioniPrimary (citable) accession number: Q8NB15
Secondary accession number(s): A8K8L5, Q8WUP1, Q96BV2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: October 1, 2002
Last modified: May 23, 2018
This is version 132 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health