Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 511

Gene

ZNF511

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri80 – 10526C2H2-type 1Add
BLAST
Zinc fingeri107 – 13024C2H2-type 2Add
BLAST
Zinc fingeri144 – 16926C2H2-type 3Add
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 511
Gene namesi
Name:ZNF511
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:28445. ZNF511.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134940031.

Polymorphism and mutation databases

BioMutaiZNF511.
DMDMi74760090.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 262262Zinc finger protein 511PRO_0000047629Add
BLAST

Proteomic databases

EPDiQ8NB15.
MaxQBiQ8NB15.
PaxDbiQ8NB15.
PRIDEiQ8NB15.

PTM databases

iPTMnetiQ8NB15.
PhosphoSiteiQ8NB15.

Expressioni

Gene expression databases

BgeeiQ8NB15.
CleanExiHS_ZNF511.
GenevisibleiQ8NB15. HS.

Organism-specific databases

HPAiHPA035360.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ISL1P613713EBI-10269136,EBI-3906896

Protein-protein interaction databases

BioGridi125611. 14 interactions.
IntActiQ8NB15. 1 interaction.
STRINGi9606.ENSP00000355251.

Structurei

3D structure databases

ProteinModelPortaliQ8NB15.
SMRiQ8NB15. Positions 79-178.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 3 C2H2-type zinc fingers.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri80 – 10526C2H2-type 1Add
BLAST
Zinc fingeri107 – 13024C2H2-type 2Add
BLAST
Zinc fingeri144 – 16926C2H2-type 3Add
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG4173. Eukaryota.
ENOG4111TX5. LUCA.
GeneTreeiENSGT00390000011381.
HOGENOMiHOG000013167.
HOVERGENiHBG094183.
InParanoidiQ8NB15.
OMAiCFGQGAA.
OrthoDBiEOG74TX1X.
PhylomeDBiQ8NB15.
TreeFamiTF323277.

Family and domain databases

Gene3Di3.30.160.60. 1 hit.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8NB15-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQLPPALCAR LAAGPGAAEP LPVERDPAAG AAPFRFVARP VRFPREHQFF
60 70 80 90 100
EDGDVQRHLY LQDVIMQVAD VPEKPRVPAF ACQVAGCCQV FDALDDYEHH
110 120 130 140 150
YHTLHGNVCS FCKRAFPSGH LLDAHILEWH DSLFQILSER QDMYQCLVEG
160 170 180 190 200
CTEKFKTSRD RKDHMVRMHL YPADFRFDKP KKSRSPASAE APGDSGERSE
210 220 230 240 250
GEAMEICSEP VAASPAPAGE RRIYRHRSVS ELFLKPVLNM CSVLRILGCT
260
WAAALLILNS ER
Length:262
Mass (Da):29,428
Last modified:October 1, 2002 - v1
Checksum:iCDBA5CD0F34EC26D
GO
Isoform 2 (identifier: Q8NB15-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     228-262: SVSELFLKPVLNMCSVLRILGCTWAAALLILNSER → IPSTICFGQGAARGFKSNKKKTKQC

Note: No experimental confirmation available.
Show »
Length:252
Mass (Da):28,265
Checksum:i06EB73C722D8BA33
GO

Sequence cautioni

The sequence AAH15139.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei228 – 26235SVSEL…LNSER → IPSTICFGQGAARGFKSNKK KTKQC in isoform 2. 1 PublicationVSP_016035Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091711 mRNA. Translation: BAC03729.1.
AK292380 mRNA. Translation: BAF85069.1.
AL360181 Genomic DNA. Translation: CAH70277.1.
AL360181 Genomic DNA. Translation: CAH70278.1.
CH471211 Genomic DNA. Translation: EAW61333.1.
BC015139 mRNA. Translation: AAH15139.1. Different initiation.
BC019897 mRNA. Translation: AAH19897.1.
CCDSiCCDS7677.1. [Q8NB15-2]
RefSeqiNP_665805.2. NM_145806.3. [Q8NB15-2]
UniGeneiHs.422113.

Genome annotation databases

EnsembliENST00000359035; ENSP00000351929; ENSG00000198546. [Q8NB15-1]
ENST00000361518; ENSP00000355251; ENSG00000198546. [Q8NB15-2]
GeneIDi118472.
KEGGihsa:118472.
UCSCiuc001lmj.2. human. [Q8NB15-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK091711 mRNA. Translation: BAC03729.1.
AK292380 mRNA. Translation: BAF85069.1.
AL360181 Genomic DNA. Translation: CAH70277.1.
AL360181 Genomic DNA. Translation: CAH70278.1.
CH471211 Genomic DNA. Translation: EAW61333.1.
BC015139 mRNA. Translation: AAH15139.1. Different initiation.
BC019897 mRNA. Translation: AAH19897.1.
CCDSiCCDS7677.1. [Q8NB15-2]
RefSeqiNP_665805.2. NM_145806.3. [Q8NB15-2]
UniGeneiHs.422113.

3D structure databases

ProteinModelPortaliQ8NB15.
SMRiQ8NB15. Positions 79-178.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125611. 14 interactions.
IntActiQ8NB15. 1 interaction.
STRINGi9606.ENSP00000355251.

PTM databases

iPTMnetiQ8NB15.
PhosphoSiteiQ8NB15.

Polymorphism and mutation databases

BioMutaiZNF511.
DMDMi74760090.

Proteomic databases

EPDiQ8NB15.
MaxQBiQ8NB15.
PaxDbiQ8NB15.
PRIDEiQ8NB15.

Protocols and materials databases

DNASUi118472.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000359035; ENSP00000351929; ENSG00000198546. [Q8NB15-1]
ENST00000361518; ENSP00000355251; ENSG00000198546. [Q8NB15-2]
GeneIDi118472.
KEGGihsa:118472.
UCSCiuc001lmj.2. human. [Q8NB15-1]

Organism-specific databases

CTDi118472.
GeneCardsiZNF511.
HGNCiHGNC:28445. ZNF511.
HPAiHPA035360.
neXtProtiNX_Q8NB15.
PharmGKBiPA134940031.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4173. Eukaryota.
ENOG4111TX5. LUCA.
GeneTreeiENSGT00390000011381.
HOGENOMiHOG000013167.
HOVERGENiHBG094183.
InParanoidiQ8NB15.
OMAiCFGQGAA.
OrthoDBiEOG74TX1X.
PhylomeDBiQ8NB15.
TreeFamiTF323277.

Miscellaneous databases

ChiTaRSiZNF511. human.
GenomeRNAii118472.
PROiQ8NB15.

Gene expression databases

BgeeiQ8NB15.
CleanExiHS_ZNF511.
GenevisibleiQ8NB15. HS.

Family and domain databases

Gene3Di3.30.160.60. 1 hit.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 3 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Chondrocyte and Testis.
  2. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain and Cervix.

Entry informationi

Entry nameiZN511_HUMAN
AccessioniPrimary (citable) accession number: Q8NB15
Secondary accession number(s): A8K8L5, Q8WUP1, Q96BV2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: October 1, 2002
Last modified: June 8, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.