Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tudor domain-containing protein 5

Gene

TDRD5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Required during spermiogenesis to participate in the repression transposable elements and prevent their mobilization, which is essential for the germline integrity. Probably acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Required for chromatoid body (CB) assembly (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Tudor domain-containing protein 5
Gene namesi
Name:TDRD5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:20614. TDRD5.

Subcellular locationi

  • Cytoplasm By similarity

  • Note: Localizes to chromatoid body (CB) and pi-body (also called intermitochondrial cementin), 2 cytoplasmic ribonucleoprotein granules involved in RNA processing for spermatogenesis.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134953461.

Polymorphism and mutation databases

BioMutaiTDRD5.
DMDMi134047943.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 981981Tudor domain-containing protein 5PRO_0000183166Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei892 – 8921PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PeptideAtlasiQ8NAT2.
PRIDEiQ8NAT2.

PTM databases

iPTMnetiQ8NAT2.

Expressioni

Gene expression databases

BgeeiQ8NAT2.
CleanExiHS_TDRD5.
ExpressionAtlasiQ8NAT2. baseline and differential.
GenevisibleiQ8NAT2. HS.

Organism-specific databases

HPAiHPA014563.
HPA029418.

Interactioni

Protein-protein interaction databases

BioGridi127869. 1 interaction.

Structurei

Secondary structure

981
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi1 – 2020Combined sources
Beta strandi21 – 244Combined sources
Helixi28 – 3912Combined sources
Helixi46 – 483Combined sources
Helixi53 – 586Combined sources
Turni61 – 633Combined sources
Beta strandi64 – 674Combined sources
Helixi70 – 723Combined sources
Beta strandi75 – 784Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3S93X-ray2.28A/B1-101[»]
ProteinModelPortaliQ8NAT2.
SMRiQ8NAT2. Positions 1-80, 482-641.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini7 – 8074HTH OST-type 1PROSITE-ProRule annotationAdd
BLAST
Domaini127 – 20276HTH OST-type 2PROSITE-ProRule annotationAdd
BLAST
Domaini295 – 36975HTH OST-type 3PROSITE-ProRule annotationAdd
BLAST
Domaini525 – 58460TudorPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the TDRD5 family.Curated
Contains 3 HTH OST-type domains.PROSITE-ProRule annotation
Contains 1 Tudor domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

GeneTreeiENSGT00730000110295.
HOGENOMiHOG000070453.
HOVERGENiHBG104306.
InParanoidiQ8NAT2.
KOiK18407.
OMAiQKLYIPR.
OrthoDBiEOG7W6WKS.
PhylomeDBiQ8NAT2.
TreeFamiTF342664.

Family and domain databases

InterProiIPR025605. OST-HTH/LOTUS_dom.
IPR002999. Tudor.
[Graphical view]
PfamiPF12872. OST-HTH. 3 hits.
PF00567. TUDOR. 1 hit.
[Graphical view]
SMARTiSM00333. TUDOR. 1 hit.
[Graphical view]
PROSITEiPS51644. HTH_OST. 3 hits.
PS50304. TUDOR. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q8NAT2-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEQERIQEC LRKEIRSLLI STKDGLSPQE LEKEYLLMVG NHLPLRILGY
60 70 80 90 100
RSTMELVLDM PDVVRVCPGA GGTVILKAIP DESTKGIASL VAKQRSSHKL
110 120 130 140 150
RNSMHKGRPS IYSGPRSHRR VPYRGRVAPI LPAVVKSELK DLLALSPVLL
160 170 180 190 200
SDFEKAFAKR FGRSFQYMQY GFLSMFEVLN AASDVISVEQ TRAGSLLMLK
210 220 230 240 250
KSVTEEKPRG CPAGKIFTQP FRMKQGSYST GFPVAKPCFS QPTSNMEPPK
260 270 280 290 300
QIMSMEKTSK LNVVETSRLN HTEKLNQLEN TFKSVIAQIG PGGTISSELK
310 320 330 340 350
HKIKFVVSKF PEGLFISKLL GEYEVIFKEQ LSPKKLGFLN VTELVGALSD
360 370 380 390 400
ILHVEFRKGH QDLLVFDADK KPLPPVQSDK KIEAKACVSS PPRNSLSTAA
410 420 430 440 450
VKETVWNCPS KKQKEPQQKI CKKPNLVVKP LQLQVETNKS ELNLAMANHD
460 470 480 490 500
IPPDAVPNKK LCRLPPLDTS SLIGVFVEYI ISPSQFYIRI YSRDSSELLE
510 520 530 540 550
DMMIEMRRCY SNQLVSDRYV MPECFIQPGH LCCVRISEDK WWYRVIIHRV
560 570 580 590 600
LEKQEVEVFY PDFGNIGIVQ KSSLRFLKCC YTKLPAQAIP CSLAWVRPVE
610 620 630 640 650
EHWTSKAILQ FQKLCGLKPL VGVVDEYVDG ILNIFLCDTS SNEDVYFHHV
660 670 680 690 700
LRTEGHAIVC RENISSKGFS ELNPLALYTT SSGGPEDIVL TELGYPSQQH
710 720 730 740 750
YFNEDRKISP QSKESELRIL DEIPTGMPCL ESVTIGDDIW DENWLPLQAK
760 770 780 790 800
MGKGGDAASH LFTASLGGKN QYSSCKEMPQ KDWCFSTPKD TWDDSWQPSG
810 820 830 840 850
LVNGTKVEVH KPEVLGAQEK NTGTNRTQKQ LDINGSSDSS TLPKLEEFCT
860 870 880 890 900
SLTQSEQSAD GSQSEPNNSQ TQPKQIQLST AAPCSTTAVD DSAEKPSGSV
910 920 930 940 950
ESSPEILKNE DFSSSRAITL YKDKRQESVD QLSLILSYEC QISQKLYIPR
960 970 980
STATAALGAA ARLATSRSLL HWYPSVKRME A
Length:981
Mass (Da):109,737
Last modified:March 20, 2007 - v3
Checksum:i09FF49592C97C574
GO
Isoform 1 (identifier: Q8NAT2-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     720-720: L → LQDINDEKSLSHLKSESKEPLKDSEFESLKTCNKSFEEDPKWSNPEPNDLKEENE

Show »
Length:1,035
Mass (Da):116,043
Checksum:iCA2E0418190DDB3A
GO

Sequence cautioni

The sequence BAC03815.1 differs from that shown. Reason: Frameshift at position 819. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti126 – 1261R → S in AAI30533 (PubMed:15489334).Curated
Sequence conflicti126 – 1261R → S in AAI44059 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti104 – 1041M → T.
Corresponds to variant rs12066948 [ dbSNP | Ensembl ].
VAR_031209
Natural varianti239 – 2391F → V.
Corresponds to variant rs12069976 [ dbSNP | Ensembl ].
VAR_052422
Natural varianti358 – 3581K → E.
Corresponds to variant rs6704505 [ dbSNP | Ensembl ].
VAR_031210
Natural varianti722 – 7221E → K.1 Publication
Corresponds to variant rs35448215 [ dbSNP | Ensembl ].
VAR_036706

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei720 – 7201L → LQDINDEKSLSHLKSESKEP LKDSEFESLKTCNKSFEEDP KWSNPEPNDLKEENE in isoform 1. 1 PublicationVSP_023968

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092142 mRNA. Translation: BAC03815.1. Frameshift.
AK127370 mRNA. Translation: BAC86946.1.
AL160286, AL590987 Genomic DNA. Translation: CAI15400.1.
AL590987 Genomic DNA. Translation: CAH73723.1.
AL590987, AL160286 Genomic DNA. Translation: CAH73724.1.
BC043368 mRNA. Translation: AAH43368.1.
BC089387 mRNA. Translation: AAH89387.1.
BC130532 mRNA. Translation: AAI30533.1.
BC144058 mRNA. Translation: AAI44059.1.
CCDSiCCDS1332.1. [Q8NAT2-3]
CCDS55663.1. [Q8NAT2-1]
RefSeqiNP_001186014.1. NM_001199085.1. [Q8NAT2-1]
NP_001186018.1. NM_001199089.1. [Q8NAT2-1]
NP_001186020.1. NM_001199091.1. [Q8NAT2-3]
NP_001186021.1. NM_001199092.1.
NP_775804.2. NM_173533.3. [Q8NAT2-3]
XP_005244991.1. XM_005244934.1. [Q8NAT2-1]
XP_005244992.1. XM_005244935.3. [Q8NAT2-1]
UniGeneiHs.197354.
Hs.739186.

Genome annotation databases

EnsembliENST00000294848; ENSP00000294848; ENSG00000162782. [Q8NAT2-3]
ENST00000367614; ENSP00000356586; ENSG00000162782. [Q8NAT2-3]
ENST00000444136; ENSP00000406052; ENSG00000162782. [Q8NAT2-1]
GeneIDi163589.
KEGGihsa:163589.
UCSCiuc001gnf.4. human. [Q8NAT2-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092142 mRNA. Translation: BAC03815.1. Frameshift.
AK127370 mRNA. Translation: BAC86946.1.
AL160286, AL590987 Genomic DNA. Translation: CAI15400.1.
AL590987 Genomic DNA. Translation: CAH73723.1.
AL590987, AL160286 Genomic DNA. Translation: CAH73724.1.
BC043368 mRNA. Translation: AAH43368.1.
BC089387 mRNA. Translation: AAH89387.1.
BC130532 mRNA. Translation: AAI30533.1.
BC144058 mRNA. Translation: AAI44059.1.
CCDSiCCDS1332.1. [Q8NAT2-3]
CCDS55663.1. [Q8NAT2-1]
RefSeqiNP_001186014.1. NM_001199085.1. [Q8NAT2-1]
NP_001186018.1. NM_001199089.1. [Q8NAT2-1]
NP_001186020.1. NM_001199091.1. [Q8NAT2-3]
NP_001186021.1. NM_001199092.1.
NP_775804.2. NM_173533.3. [Q8NAT2-3]
XP_005244991.1. XM_005244934.1. [Q8NAT2-1]
XP_005244992.1. XM_005244935.3. [Q8NAT2-1]
UniGeneiHs.197354.
Hs.739186.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3S93X-ray2.28A/B1-101[»]
ProteinModelPortaliQ8NAT2.
SMRiQ8NAT2. Positions 1-80, 482-641.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127869. 1 interaction.

PTM databases

iPTMnetiQ8NAT2.

Polymorphism and mutation databases

BioMutaiTDRD5.
DMDMi134047943.

Proteomic databases

PeptideAtlasiQ8NAT2.
PRIDEiQ8NAT2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294848; ENSP00000294848; ENSG00000162782. [Q8NAT2-3]
ENST00000367614; ENSP00000356586; ENSG00000162782. [Q8NAT2-3]
ENST00000444136; ENSP00000406052; ENSG00000162782. [Q8NAT2-1]
GeneIDi163589.
KEGGihsa:163589.
UCSCiuc001gnf.4. human. [Q8NAT2-3]

Organism-specific databases

CTDi163589.
GeneCardsiTDRD5.
HGNCiHGNC:20614. TDRD5.
HPAiHPA014563.
HPA029418.
neXtProtiNX_Q8NAT2.
PharmGKBiPA134953461.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00730000110295.
HOGENOMiHOG000070453.
HOVERGENiHBG104306.
InParanoidiQ8NAT2.
KOiK18407.
OMAiQKLYIPR.
OrthoDBiEOG7W6WKS.
PhylomeDBiQ8NAT2.
TreeFamiTF342664.

Miscellaneous databases

GenomeRNAii163589.
PROiQ8NAT2.

Gene expression databases

BgeeiQ8NAT2.
CleanExiHS_TDRD5.
ExpressionAtlasiQ8NAT2. baseline and differential.
GenevisibleiQ8NAT2. HS.

Family and domain databases

InterProiIPR025605. OST-HTH/LOTUS_dom.
IPR002999. Tudor.
[Graphical view]
PfamiPF12872. OST-HTH. 3 hits.
PF00567. TUDOR. 1 hit.
[Graphical view]
SMARTiSM00333. TUDOR. 1 hit.
[Graphical view]
PROSITEiPS51644. HTH_OST. 3 hits.
PS50304. TUDOR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Substantia nigra.
  2. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 195-981 (ISOFORM 3), VARIANT LYS-722.
    Tissue: Brain and Testis.
  4. "OST-HTH: a novel predicted RNA-binding domain."
    Anantharaman V., Zhang D., Aravind L.
    Biol. Direct 5:13-13(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION OF THE HTH OST-TYPE DOMAIN.
  5. "LOTUS, a new domain associated with small RNA pathways in the germline."
    Callebaut I., Mornon J.P.
    Bioinformatics 26:1140-1144(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION OF THE HTH OST-TYPE DOMAIN.
  6. "Crystal structure of conserved motif in TDRD5."
    Structural genomics consortium (SGC)
    Submitted (AUG-2011) to the PDB data bank
    Cited for: X-RAY CRYSTALLOGRAPHY (2.28 ANGSTROMS) OF 1-101.

Entry informationi

Entry nameiTDRD5_HUMAN
AccessioniPrimary (citable) accession number: Q8NAT2
Secondary accession number(s): A1L4G5
, B7ZLV0, Q5EBN4, Q5VTV0, Q6ZSK2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 25, 2003
Last sequence update: March 20, 2007
Last modified: July 6, 2016
This is version 116 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.