Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tudor domain-containing protein 5

Gene

TDRD5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Required during spermiogenesis to participate in the repression transposable elements and prevent their mobilization, which is essential for the germline integrity. Probably acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Required for chromatoid body (CB) assembly (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Enzyme and pathway databases

BioCyciZFISH:ENSG00000162782-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Tudor domain-containing protein 5
Gene namesi
Name:TDRD5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:20614. TDRD5.

Subcellular locationi

  • Cytoplasm By similarity

  • Note: Localizes to chromatoid body (CB) and pi-body (also called intermitochondrial cementin), 2 cytoplasmic ribonucleoprotein granules involved in RNA processing for spermatogenesis.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi163589.
OpenTargetsiENSG00000162782.
PharmGKBiPA134953461.

Polymorphism and mutation databases

BioMutaiTDRD5.
DMDMi134047943.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001831661 – 981Tudor domain-containing protein 5Add BLAST981

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei892PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PeptideAtlasiQ8NAT2.
PRIDEiQ8NAT2.

PTM databases

iPTMnetiQ8NAT2.
PhosphoSitePlusiQ8NAT2.

Expressioni

Gene expression databases

BgeeiENSG00000162782.
CleanExiHS_TDRD5.
ExpressionAtlasiQ8NAT2. baseline and differential.
GenevisibleiQ8NAT2. HS.

Organism-specific databases

HPAiHPA014563.
HPA029418.

Interactioni

Protein-protein interaction databases

BioGridi127869. 1 interactor.

Structurei

Secondary structure

1981
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi1 – 20Combined sources20
Beta strandi21 – 24Combined sources4
Helixi28 – 39Combined sources12
Helixi46 – 48Combined sources3
Helixi53 – 58Combined sources6
Turni61 – 63Combined sources3
Beta strandi64 – 67Combined sources4
Helixi70 – 72Combined sources3
Beta strandi75 – 78Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3S93X-ray2.28A/B1-101[»]
ProteinModelPortaliQ8NAT2.
SMRiQ8NAT2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini7 – 80HTH OST-type 1PROSITE-ProRule annotationAdd BLAST74
Domaini127 – 202HTH OST-type 2PROSITE-ProRule annotationAdd BLAST76
Domaini295 – 369HTH OST-type 3PROSITE-ProRule annotationAdd BLAST75
Domaini525 – 584TudorPROSITE-ProRule annotationAdd BLAST60

Sequence similaritiesi

Belongs to the TDRD5 family.Curated
Contains 3 HTH OST-type domains.PROSITE-ProRule annotation
Contains 1 Tudor domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

GeneTreeiENSGT00730000110295.
HOGENOMiHOG000070453.
HOVERGENiHBG104306.
InParanoidiQ8NAT2.
KOiK18407.
OMAiQKLYIPR.
OrthoDBiEOG091G00Z5.
PhylomeDBiQ8NAT2.
TreeFamiTF342664.

Family and domain databases

InterProiIPR025605. OST-HTH/LOTUS_dom.
IPR002999. Tudor.
[Graphical view]
PfamiPF12872. OST-HTH. 3 hits.
PF00567. TUDOR. 1 hit.
[Graphical view]
SMARTiSM00333. TUDOR. 1 hit.
[Graphical view]
PROSITEiPS51644. HTH_OST. 3 hits.
PS50304. TUDOR. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q8NAT2-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEQERIQEC LRKEIRSLLI STKDGLSPQE LEKEYLLMVG NHLPLRILGY
60 70 80 90 100
RSTMELVLDM PDVVRVCPGA GGTVILKAIP DESTKGIASL VAKQRSSHKL
110 120 130 140 150
RNSMHKGRPS IYSGPRSHRR VPYRGRVAPI LPAVVKSELK DLLALSPVLL
160 170 180 190 200
SDFEKAFAKR FGRSFQYMQY GFLSMFEVLN AASDVISVEQ TRAGSLLMLK
210 220 230 240 250
KSVTEEKPRG CPAGKIFTQP FRMKQGSYST GFPVAKPCFS QPTSNMEPPK
260 270 280 290 300
QIMSMEKTSK LNVVETSRLN HTEKLNQLEN TFKSVIAQIG PGGTISSELK
310 320 330 340 350
HKIKFVVSKF PEGLFISKLL GEYEVIFKEQ LSPKKLGFLN VTELVGALSD
360 370 380 390 400
ILHVEFRKGH QDLLVFDADK KPLPPVQSDK KIEAKACVSS PPRNSLSTAA
410 420 430 440 450
VKETVWNCPS KKQKEPQQKI CKKPNLVVKP LQLQVETNKS ELNLAMANHD
460 470 480 490 500
IPPDAVPNKK LCRLPPLDTS SLIGVFVEYI ISPSQFYIRI YSRDSSELLE
510 520 530 540 550
DMMIEMRRCY SNQLVSDRYV MPECFIQPGH LCCVRISEDK WWYRVIIHRV
560 570 580 590 600
LEKQEVEVFY PDFGNIGIVQ KSSLRFLKCC YTKLPAQAIP CSLAWVRPVE
610 620 630 640 650
EHWTSKAILQ FQKLCGLKPL VGVVDEYVDG ILNIFLCDTS SNEDVYFHHV
660 670 680 690 700
LRTEGHAIVC RENISSKGFS ELNPLALYTT SSGGPEDIVL TELGYPSQQH
710 720 730 740 750
YFNEDRKISP QSKESELRIL DEIPTGMPCL ESVTIGDDIW DENWLPLQAK
760 770 780 790 800
MGKGGDAASH LFTASLGGKN QYSSCKEMPQ KDWCFSTPKD TWDDSWQPSG
810 820 830 840 850
LVNGTKVEVH KPEVLGAQEK NTGTNRTQKQ LDINGSSDSS TLPKLEEFCT
860 870 880 890 900
SLTQSEQSAD GSQSEPNNSQ TQPKQIQLST AAPCSTTAVD DSAEKPSGSV
910 920 930 940 950
ESSPEILKNE DFSSSRAITL YKDKRQESVD QLSLILSYEC QISQKLYIPR
960 970 980
STATAALGAA ARLATSRSLL HWYPSVKRME A
Length:981
Mass (Da):109,737
Last modified:March 20, 2007 - v3
Checksum:i09FF49592C97C574
GO
Isoform 1 (identifier: Q8NAT2-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     720-720: L → LQDINDEKSLSHLKSESKEPLKDSEFESLKTCNKSFEEDPKWSNPEPNDLKEENE

Show »
Length:1,035
Mass (Da):116,043
Checksum:iCA2E0418190DDB3A
GO

Sequence cautioni

The sequence BAC03815 differs from that shown. Reason: Frameshift at position 819.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti126R → S in AAI30533 (PubMed:15489334).Curated1
Sequence conflicti126R → S in AAI44059 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031209104M → T.Corresponds to variant rs12066948dbSNPEnsembl.1
Natural variantiVAR_052422239F → V.Corresponds to variant rs12069976dbSNPEnsembl.1
Natural variantiVAR_031210358K → E.Corresponds to variant rs6704505dbSNPEnsembl.1
Natural variantiVAR_036706722E → K.1 PublicationCorresponds to variant rs35448215dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_023968720L → LQDINDEKSLSHLKSESKEP LKDSEFESLKTCNKSFEEDP KWSNPEPNDLKEENE in isoform 1. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092142 mRNA. Translation: BAC03815.1. Frameshift.
AK127370 mRNA. Translation: BAC86946.1.
AL160286, AL590987 Genomic DNA. Translation: CAI15400.1.
AL590987 Genomic DNA. Translation: CAH73723.1.
AL590987, AL160286 Genomic DNA. Translation: CAH73724.1.
BC043368 mRNA. Translation: AAH43368.1.
BC089387 mRNA. Translation: AAH89387.1.
BC130532 mRNA. Translation: AAI30533.1.
BC144058 mRNA. Translation: AAI44059.1.
CCDSiCCDS1332.1. [Q8NAT2-3]
CCDS55663.1. [Q8NAT2-1]
RefSeqiNP_001186014.1. NM_001199085.1. [Q8NAT2-1]
NP_001186018.1. NM_001199089.1. [Q8NAT2-1]
NP_001186020.1. NM_001199091.1. [Q8NAT2-3]
NP_001186021.1. NM_001199092.1.
NP_775804.2. NM_173533.3. [Q8NAT2-3]
XP_005244991.1. XM_005244934.1. [Q8NAT2-1]
XP_005244992.1. XM_005244935.4. [Q8NAT2-1]
XP_016855962.1. XM_017000473.1. [Q8NAT2-3]
UniGeneiHs.197354.
Hs.739186.

Genome annotation databases

EnsembliENST00000294848; ENSP00000294848; ENSG00000162782. [Q8NAT2-3]
ENST00000367614; ENSP00000356586; ENSG00000162782. [Q8NAT2-3]
ENST00000444136; ENSP00000406052; ENSG00000162782. [Q8NAT2-1]
GeneIDi163589.
KEGGihsa:163589.
UCSCiuc001gnf.4. human. [Q8NAT2-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092142 mRNA. Translation: BAC03815.1. Frameshift.
AK127370 mRNA. Translation: BAC86946.1.
AL160286, AL590987 Genomic DNA. Translation: CAI15400.1.
AL590987 Genomic DNA. Translation: CAH73723.1.
AL590987, AL160286 Genomic DNA. Translation: CAH73724.1.
BC043368 mRNA. Translation: AAH43368.1.
BC089387 mRNA. Translation: AAH89387.1.
BC130532 mRNA. Translation: AAI30533.1.
BC144058 mRNA. Translation: AAI44059.1.
CCDSiCCDS1332.1. [Q8NAT2-3]
CCDS55663.1. [Q8NAT2-1]
RefSeqiNP_001186014.1. NM_001199085.1. [Q8NAT2-1]
NP_001186018.1. NM_001199089.1. [Q8NAT2-1]
NP_001186020.1. NM_001199091.1. [Q8NAT2-3]
NP_001186021.1. NM_001199092.1.
NP_775804.2. NM_173533.3. [Q8NAT2-3]
XP_005244991.1. XM_005244934.1. [Q8NAT2-1]
XP_005244992.1. XM_005244935.4. [Q8NAT2-1]
XP_016855962.1. XM_017000473.1. [Q8NAT2-3]
UniGeneiHs.197354.
Hs.739186.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3S93X-ray2.28A/B1-101[»]
ProteinModelPortaliQ8NAT2.
SMRiQ8NAT2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127869. 1 interactor.

PTM databases

iPTMnetiQ8NAT2.
PhosphoSitePlusiQ8NAT2.

Polymorphism and mutation databases

BioMutaiTDRD5.
DMDMi134047943.

Proteomic databases

PeptideAtlasiQ8NAT2.
PRIDEiQ8NAT2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294848; ENSP00000294848; ENSG00000162782. [Q8NAT2-3]
ENST00000367614; ENSP00000356586; ENSG00000162782. [Q8NAT2-3]
ENST00000444136; ENSP00000406052; ENSG00000162782. [Q8NAT2-1]
GeneIDi163589.
KEGGihsa:163589.
UCSCiuc001gnf.4. human. [Q8NAT2-3]

Organism-specific databases

CTDi163589.
DisGeNETi163589.
GeneCardsiTDRD5.
HGNCiHGNC:20614. TDRD5.
HPAiHPA014563.
HPA029418.
neXtProtiNX_Q8NAT2.
OpenTargetsiENSG00000162782.
PharmGKBiPA134953461.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00730000110295.
HOGENOMiHOG000070453.
HOVERGENiHBG104306.
InParanoidiQ8NAT2.
KOiK18407.
OMAiQKLYIPR.
OrthoDBiEOG091G00Z5.
PhylomeDBiQ8NAT2.
TreeFamiTF342664.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000162782-MONOMER.

Miscellaneous databases

GenomeRNAii163589.
PROiQ8NAT2.

Gene expression databases

BgeeiENSG00000162782.
CleanExiHS_TDRD5.
ExpressionAtlasiQ8NAT2. baseline and differential.
GenevisibleiQ8NAT2. HS.

Family and domain databases

InterProiIPR025605. OST-HTH/LOTUS_dom.
IPR002999. Tudor.
[Graphical view]
PfamiPF12872. OST-HTH. 3 hits.
PF00567. TUDOR. 1 hit.
[Graphical view]
SMARTiSM00333. TUDOR. 1 hit.
[Graphical view]
PROSITEiPS51644. HTH_OST. 3 hits.
PS50304. TUDOR. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTDRD5_HUMAN
AccessioniPrimary (citable) accession number: Q8NAT2
Secondary accession number(s): A1L4G5
, B7ZLV0, Q5EBN4, Q5VTV0, Q6ZSK2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 25, 2003
Last sequence update: March 20, 2007
Last modified: November 2, 2016
This is version 119 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.