Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tudor domain-containing protein 5

Gene

TDRD5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Required during spermiogenesis to participate in the repression transposable elements and prevent their mobilization, which is essential for the germline integrity. Probably acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and govern the methylation and subsequent repression of transposons. Required for chromatoid body (CB) assembly (By similarity).By similarity

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Spermatogenesis

Names & Taxonomyi

Protein namesi
Recommended name:
Tudor domain-containing protein 5
Gene namesi
Name:TDRD5
Synonyms:TUDOR3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000162782.15
HGNCiHGNC:20614 TDRD5
MIMi617748 gene
neXtProtiNX_Q8NAT2

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi163589
OpenTargetsiENSG00000162782
PharmGKBiPA134953461

Polymorphism and mutation databases

BioMutaiTDRD5
DMDMi134047943

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001831661 – 981Tudor domain-containing protein 5Add BLAST981

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei892PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PeptideAtlasiQ8NAT2
PRIDEiQ8NAT2
ProteomicsDBi72696
72697 [Q8NAT2-1]

PTM databases

iPTMnetiQ8NAT2
PhosphoSitePlusiQ8NAT2

Expressioni

Gene expression databases

BgeeiENSG00000162782
CleanExiHS_TDRD5
ExpressionAtlasiQ8NAT2 baseline and differential
GenevisibleiQ8NAT2 HS

Organism-specific databases

HPAiHPA029418

Interactioni

Protein-protein interaction databases

BioGridi127869, 1 interactor

Structurei

Secondary structure

1981
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi1 – 20Combined sources20
Beta strandi21 – 24Combined sources4
Helixi28 – 39Combined sources12
Helixi46 – 48Combined sources3
Helixi53 – 58Combined sources6
Turni61 – 63Combined sources3
Beta strandi64 – 67Combined sources4
Helixi70 – 72Combined sources3
Beta strandi75 – 78Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3S93X-ray2.28A/B1-101[»]
ProteinModelPortaliQ8NAT2
SMRiQ8NAT2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini7 – 80HTH OST-type 1PROSITE-ProRule annotationAdd BLAST74
Domaini127 – 202HTH OST-type 2PROSITE-ProRule annotationAdd BLAST76
Domaini295 – 369HTH OST-type 3PROSITE-ProRule annotationAdd BLAST75
Domaini525 – 584TudorPROSITE-ProRule annotationAdd BLAST60

Sequence similaritiesi

Belongs to the TDRD5 family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

GeneTreeiENSGT00730000110295
HOGENOMiHOG000070453
HOVERGENiHBG104306
InParanoidiQ8NAT2
KOiK18407
OMAiQKLYIPR
OrthoDBiEOG091G00Z5
PhylomeDBiQ8NAT2
TreeFamiTF342664

Family and domain databases

CDDicd09975 LOTUS_2_TDRD5, 1 hit
Gene3Di2.40.50.90, 2 hits
InterProiView protein in InterPro
IPR025605 OST-HTH/LOTUS_dom
IPR035437 SNase_OB-fold_sf
IPR037982 TDRD5_LOTUS_2
IPR002999 Tudor
PfamiView protein in Pfam
PF12872 OST-HTH, 3 hits
PF00567 TUDOR, 1 hit
SMARTiView protein in SMART
SM00333 TUDOR, 1 hit
PROSITEiView protein in PROSITE
PS51644 HTH_OST, 3 hits
PS50304 TUDOR, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 3 (identifier: Q8NAT2-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEQERIQEC LRKEIRSLLI STKDGLSPQE LEKEYLLMVG NHLPLRILGY
60 70 80 90 100
RSTMELVLDM PDVVRVCPGA GGTVILKAIP DESTKGIASL VAKQRSSHKL
110 120 130 140 150
RNSMHKGRPS IYSGPRSHRR VPYRGRVAPI LPAVVKSELK DLLALSPVLL
160 170 180 190 200
SDFEKAFAKR FGRSFQYMQY GFLSMFEVLN AASDVISVEQ TRAGSLLMLK
210 220 230 240 250
KSVTEEKPRG CPAGKIFTQP FRMKQGSYST GFPVAKPCFS QPTSNMEPPK
260 270 280 290 300
QIMSMEKTSK LNVVETSRLN HTEKLNQLEN TFKSVIAQIG PGGTISSELK
310 320 330 340 350
HKIKFVVSKF PEGLFISKLL GEYEVIFKEQ LSPKKLGFLN VTELVGALSD
360 370 380 390 400
ILHVEFRKGH QDLLVFDADK KPLPPVQSDK KIEAKACVSS PPRNSLSTAA
410 420 430 440 450
VKETVWNCPS KKQKEPQQKI CKKPNLVVKP LQLQVETNKS ELNLAMANHD
460 470 480 490 500
IPPDAVPNKK LCRLPPLDTS SLIGVFVEYI ISPSQFYIRI YSRDSSELLE
510 520 530 540 550
DMMIEMRRCY SNQLVSDRYV MPECFIQPGH LCCVRISEDK WWYRVIIHRV
560 570 580 590 600
LEKQEVEVFY PDFGNIGIVQ KSSLRFLKCC YTKLPAQAIP CSLAWVRPVE
610 620 630 640 650
EHWTSKAILQ FQKLCGLKPL VGVVDEYVDG ILNIFLCDTS SNEDVYFHHV
660 670 680 690 700
LRTEGHAIVC RENISSKGFS ELNPLALYTT SSGGPEDIVL TELGYPSQQH
710 720 730 740 750
YFNEDRKISP QSKESELRIL DEIPTGMPCL ESVTIGDDIW DENWLPLQAK
760 770 780 790 800
MGKGGDAASH LFTASLGGKN QYSSCKEMPQ KDWCFSTPKD TWDDSWQPSG
810 820 830 840 850
LVNGTKVEVH KPEVLGAQEK NTGTNRTQKQ LDINGSSDSS TLPKLEEFCT
860 870 880 890 900
SLTQSEQSAD GSQSEPNNSQ TQPKQIQLST AAPCSTTAVD DSAEKPSGSV
910 920 930 940 950
ESSPEILKNE DFSSSRAITL YKDKRQESVD QLSLILSYEC QISQKLYIPR
960 970 980
STATAALGAA ARLATSRSLL HWYPSVKRME A
Length:981
Mass (Da):109,737
Last modified:March 20, 2007 - v3
Checksum:i09FF49592C97C574
GO
Isoform 1 (identifier: Q8NAT2-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     720-720: L → LQDINDEKSLSHLKSESKEPLKDSEFESLKTCNKSFEEDPKWSNPEPNDLKEENE

Show »
Length:1,035
Mass (Da):116,043
Checksum:iCA2E0418190DDB3A
GO

Sequence cautioni

The sequence BAC03815 differs from that shown. Reason: Frameshift at position 819.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti126R → S in AAI30533 (PubMed:15489334).Curated1
Sequence conflicti126R → S in AAI44059 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_031209104M → T. Corresponds to variant dbSNP:rs12066948Ensembl.1
Natural variantiVAR_052422239F → V. Corresponds to variant dbSNP:rs12069976Ensembl.1
Natural variantiVAR_031210358K → E. Corresponds to variant dbSNP:rs6704505Ensembl.1
Natural variantiVAR_036706722E → K1 PublicationCorresponds to variant dbSNP:rs35448215Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_023968720L → LQDINDEKSLSHLKSESKEP LKDSEFESLKTCNKSFEEDP KWSNPEPNDLKEENE in isoform 1. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092142 mRNA Translation: BAC03815.1 Frameshift.
AK127370 mRNA Translation: BAC86946.1
AL160286 Genomic DNA No translation available.
AL590987 Genomic DNA No translation available.
BC043368 mRNA Translation: AAH43368.1
BC089387 mRNA Translation: AAH89387.1
BC130532 mRNA Translation: AAI30533.1
BC144058 mRNA Translation: AAI44059.1
CCDSiCCDS1332.1 [Q8NAT2-3]
CCDS55663.1 [Q8NAT2-1]
RefSeqiNP_001186014.1, NM_001199085.1 [Q8NAT2-1]
NP_001186018.1, NM_001199089.1 [Q8NAT2-1]
NP_001186020.1, NM_001199091.1 [Q8NAT2-3]
NP_001186021.1, NM_001199092.1
NP_775804.2, NM_173533.3 [Q8NAT2-3]
XP_005244991.1, XM_005244934.1 [Q8NAT2-1]
XP_005244992.1, XM_005244935.4 [Q8NAT2-1]
XP_016855962.1, XM_017000473.1
UniGeneiHs.197354
Hs.739186

Genome annotation databases

EnsembliENST00000294848; ENSP00000294848; ENSG00000162782 [Q8NAT2-3]
ENST00000367614; ENSP00000356586; ENSG00000162782 [Q8NAT2-3]
ENST00000444136; ENSP00000406052; ENSG00000162782 [Q8NAT2-1]
GeneIDi163589
KEGGihsa:163589
UCSCiuc001gnf.4 human [Q8NAT2-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiTDRD5_HUMAN
AccessioniPrimary (citable) accession number: Q8NAT2
Secondary accession number(s): A1L4G5
, B7ZLV0, Q5EBN4, Q5VTV0, Q6ZSK2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 25, 2003
Last sequence update: March 20, 2007
Last modified: June 20, 2018
This is version 129 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health