Q8N9W6 (BOLL_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Protein boule-like | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 283 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation By similarity. |
| Subunit structure | Interacts with DAZ1 and DAZL. Ref.1 |
| Subcellular location | |
| Tissue specificity | Testis specific. Not expressed in early embryos, primoridal germ cells and spermatogonial cells. First expressed in the cytoplasm of spermatocytes and then persists through meiosis. Ref.1 Ref.2 |
| Sequence similarities | Belongs to the RRM DAZ family. Contains 1 DAZ-like domain. Contains 1 RRM (RNA recognition motif) domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N9W6-1) Also known as: BOULE2; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N9W6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MQTSNQM 184-184: Q → QGIKQCHTRRWMDSLLPFTKCDE 277-283: TVWSIHY → CGAFIIKTIGQLYSSSTDFLSNDPCVAEIQLQRTS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q8N9W6-3) Also known as: BOULE1; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → METESGPQTSNQM | ||||||
| Isoform 4 (identifier: Q8N9W6-4) Also known as: BOULE3; The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MQTSNQM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 283 | 283 | Protein boule-like | PRO_0000081494 | |||||
Regions | |||||||||
| Domain | 33 – 110 | 78 | RRM | ||||||
| Domain | 164 – 194 | 31 | DAZ-like | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MQTSNQM in isoform 2 and isoform 4. | VSP_009444 | |||||
| Alternative sequence | 1 | 1 | M → METESGPQTSNQM in isoform 3. | VSP_036805 | |||||
| Alternative sequence | 184 | 1 | Q → QGIKQCHTRRWMDSLLPFTK CDE in isoform 2. | VSP_009445 | |||||
| Alternative sequence | 277 – 283 | 7 | TVWSIHY → CGAFIIKTIGQLYSSSTDFL SNDPCVAEIQLQRTS in isoform 2. | VSP_009446 | |||||
Experimental info | |||||||||
| Sequence conflict | 164 | 1 | V → A in BAC04171. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A gene family required for human germ cell development evolved from an ancient meiotic gene conserved in metazoans." Xu E.Y., Moore F.L., Reijo Pera R.A. Proc. Natl. Acad. Sci. U.S.A. 98:7414-7419(2001) [PubMed: 11390979] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH DAZ1 AND DAZL. |
| [2] | "Association of three isoforms of the meiotic BOULE gene with spermatogenic failure in infertile men." Kostova E., Yeung C.H., Luetjens C.M., Brune M., Nieschlag E., Gromoll J. Mol. Hum. Reprod. 13:85-93(2007) [PubMed: 17114206] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 3 AND 4), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Testis. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Testis. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF272858 mRNA. Translation: AAK58689.1. AM295005 mRNA. Translation: CAL25726.1. AK058099 mRNA. Translation: BAB71664.1. AK093453 mRNA. Translation: BAC04171.1. AK097795 mRNA. No translation available. AC011997 Genomic DNA. Translation: AAX93045.1. CH471063 Genomic DNA. Translation: EAW70172.1. BC033674 mRNA. Translation: AAH33674.1. |
| IPI | IPI00056506. IPI00377133. IPI00396276. IPI00871244. |
| RefSeq | NP_149019.1. NM_033030.5. NP_932074.1. NM_197970.2. |
| UniGene | Hs.169797. |
3D structure databases | |
| ProteinModelPortal | Q8N9W6. |
| SMR | Q8N9W6. Positions 28-112. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8N9W6. 1 interaction. |
| STRING | Q8N9W6. |
PTM databases | |
| PhosphoSite | Q8N9W6. |
Polymorphism databases | |
| DMDM | 44887719. |
Proteomic databases | |
| PRIDE | Q8N9W6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000282278; ENSP00000282278; ENSG00000152430. ENST00000321801; ENSP00000314792; ENSG00000152430. ENST00000392296; ENSP00000376116; ENSG00000152430. |
| GeneID | 66037. |
| KEGG | hsa:66037. |
| UCSC | uc002uus.2. human. |
Organism-specific databases | |
| CTD | 66037. |
| GeneCards | GC02M198591. |
| H-InvDB | HIX0002713. HIX0030239. |
| HGNC | HGNC:14273. BOLL. |
| HPA | HPA018678. |
| MIM | 606165. gene. |
| neXtProt | NX_Q8N9W6. |
| PharmGKB | PA25397. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG18772. |
| GeneTree | ENSGT00530000063480. |
| HOVERGEN | HBG048761. |
| OrthoDB | EOG4MPHQQ. |
Gene expression databases | |
| ArrayExpress | Q8N9W6. |
| Bgee | Q8N9W6. |
| CleanEx | HS_BOLL. |
| Genevestigator | Q8N9W6. |
| GermOnline | ENSG00000152430. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR012677. Nucleotide-bd_a/b_plait. IPR000504. RRM_dom. [Graphical view] |
| Gene3D | G3DSA:3.30.70.330. a_b_plait_nuc_bd. 1 hit. |
| Pfam | PF00076. RRM_1. 1 hit. [Graphical view] |
| SMART | SM00360. RRM. 1 hit. [Graphical view] |
| PROSITE | PS50102. RRM. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 67546. |
| SOURCE | Search... |
Entry information
| Entry name | BOLL_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N9W6 Secondary accession number(s): Q0JW32, Q53T62, Q969U3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with