Q8N9W5 (DAAF3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 72.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dynein assembly factor 3, axonemal | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 541 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Required for the assembly of axonemal inner and outer dynein arms. Involved in preassembly of dyneins into complexes before their transport into cilia. Ref.4 |
| Subcellular location | Cytoplasm By similarity. |
| Involvement in disease | Primary ciliary dyskinesia 2 (CILD2) [MIM:606763]: A disorder characterized by abnormalities of motile cilia. Respiratory infections leading to chronic inflammation and bronchiectasis are recurrent, due to defects in the respiratory cilia; reduced fertility is often observed in male patients due to abnormalities of sperm tails. Half of the patients exhibit randomization of left-right body asymmetry and situs inversus, due to dysfunction of monocilia at the embryonic node. Primary ciliary dyskinesia associated with situs inversus is referred to as Kartagener syndrome. |
| Sequence similarities | Belongs to the DNAAF3 family. |
| Sequence caution | The sequence AAH63449.1 differs from that shown. Reason: Erroneous translation. Wrong choice of CDS. The sequence BAC04177.1 differs from that shown. Reason: Probable cloning artifact. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cilium biogenesis/degradation |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Ciliopathy Disease mutation Primary ciliary dyskinesia |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | axonemal dynein complex assembly Inferred from mutant phenotype Ref.4. Source: UniProtKB motile cilium assemblyInferred from mutant phenotype Ref.4. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N9W5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N9W5-5) The sequence of this isoform differs from the canonical sequence as follows: 77-95: FFVLENNLEAVARHMLIFS → VSWDEDESPDSRVLEGGRD 96-541: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: Q8N9W5-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLPLLDSSKRAGTLGSGCGVPRVHSAALSREEGASRDIWRIKVWARVM 29-29: S → RDATVDALPTTMVPQPAVILPG 350-350: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q8N9W5-6) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLPLLDSSKRAGTLGSGCGVPRVHSAALSREEGASRDIWRIKVWARVM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 541 | 541 | Dynein assembly factor 3, axonemal | PRO_0000297580 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MLPLLDSSKRAGTLGSGCGV PRVHSAALSREEGASRDIWR IKVWARVM in isoform 3 and isoform 4. | VSP_042976 | |||||
| Alternative sequence | 29 | 1 | S → RDATVDALPTTMVPQPAVIL PG in isoform 3. | VSP_039966 | |||||
| Alternative sequence | 77 – 95 | 19 | FFVLE…MLIFS → VSWDEDESPDSRVLEGGRD in isoform 2. | VSP_039967 | |||||
| Alternative sequence | 96 – 541 | 446 | Missing in isoform 2. | VSP_039968 | |||||
| Alternative sequence | 350 | 1 | Missing in isoform 3. | VSP_039969 | |||||
| Natural variant | 61 | 1 | L → P in CILD2. Ref.4 | VAR_067300 | |||||
| Natural variant | 278 | 1 | A → T. Ref.4 | VAR_067301 | |||||
| Natural variant | 292 | 1 | E → G. Corresponds to variant rs2365725 [ dbSNP | Ensembl ]. | VAR_055306 | |||||
| Natural variant | 331 | 1 | G → W. Corresponds to variant rs7508641 [ dbSNP | Ensembl ]. | VAR_055307 | |||||
| Natural variant | 365 | 1 | D → N. Ref.1 Ref.3 Corresponds to variant rs890872 [ dbSNP | Ensembl ]. | VAR_055308 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK093458 mRNA. Translation: BAC04172.1. AK093473 mRNA. Translation: BAC04177.1. Sequence problems. AK097388 mRNA. Translation: BAC05029.1. AC010327 Genomic DNA. No translation available. BC016843 mRNA. Translation: AAH16843.1. BC063449 mRNA. Translation: AAH63449.1. Sequence problems. |
| IPI | IPI00167830. IPI00550238. IPI00971028. |
| RefSeq | NP_001243643.1. NM_001256714.1. NP_001243644.1. NM_001256715.1. NP_001243645.1. NM_001256716.1. NP_849159.2. NM_178837.4. |
| UniGene | Hs.351582. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000375600. |
PTM databases | |
| PhosphoSite | Q8N9W5. |
Polymorphism databases | |
| DMDM | 229462985. |
Proteomic databases | |
| PaxDb | Q8N9W5. |
| PRIDE | Q8N9W5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000391719; ENSP00000375599; ENSG00000167646. ENST00000391720; ENSP00000375600; ENSG00000167646. ENST00000524407; ENSP00000432046; ENSG00000167646. ENST00000527223; ENSP00000436975; ENSG00000167646. ENST00000528412; ENSP00000433826; ENSG00000167646. ENST00000534214; ENSP00000433247; ENSG00000167646. |
| GeneID | 352909. |
| KEGG | hsa:352909. |
| UCSC | uc002qjh.1. human. |
Organism-specific databases | |
| CTD | 352909. |
| GeneCards | GC19M055671. |
| HGNC | HGNC:30492. DNAAF3. |
| HPA | HPA042118. |
| MIM | 606763. phenotype. 614566. gene. |
| neXtProt | NX_Q8N9W5. |
| Orphanet | 244. Primary ciliary dyskinesia. |
| PharmGKB | PA147358371. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG85125. |
| HOGENOM | HOG000060295. |
| HOVERGEN | HBG107764. |
| OMA | TFARFYK. |
Gene expression databases | |
| ArrayExpress | Q8N9W5. |
| Bgee | Q8N9W5. |
| CleanEx | HS_C19orf51. |
| Genevestigator | Q8N9W5. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 352909. |
| NextBio | 99561. |
| SOURCE | Search... |
Entry information
| Entry name | DAAF3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N9W5 Secondary accession number(s): A8MUY0 Q96AR2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Uncharacterized protein families (UPF) List of uncharacterized protein family (UPF) entries |
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
