Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Activator of 90 kDa heat shock protein ATPase homolog 2

Gene

Ahsa2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Functioni

Co-chaperone that stimulates HSP90 ATPase activity.By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chaperone

Keywords - Biological processi

Stress response

Names & Taxonomyi

Protein namesi
Recommended name:
Activator of 90 kDa heat shock protein ATPase homolog 2
Gene namesi
Name:Ahsa2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1916133. Ahsa2.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 331331Activator of 90 kDa heat shock protein ATPase homolog 2PRO_0000315606Add
BLAST

Proteomic databases

EPDiQ8N9S3.
MaxQBiQ8N9S3.
PaxDbiQ8N9S3.
PRIDEiQ8N9S3.

PTM databases

iPTMnetiQ8N9S3.
PhosphoSiteiQ8N9S3.

Expressioni

Gene expression databases

BgeeiQ8N9S3.
ExpressionAtlasiQ8N9S3. baseline and differential.
GenevisibleiQ8N9S3. MM.

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000020529.

Structurei

3D structure databases

ProteinModelPortaliQ8N9S3.
SMRiQ8N9S3. Positions 25-155, 197-321.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AHA1 family.Curated

Phylogenomic databases

eggNOGiKOG2936. Eukaryota.
COG5580. LUCA.
GeneTreeiENSGT00390000006429.
HOGENOMiHOG000242852.
HOVERGENiHBG065806.
InParanoidiQ8N9S3.
OMAiKESGEKH.
OrthoDBiEOG77DJ64.
PhylomeDBiQ8N9S3.
TreeFamiTF313680.

Family and domain databases

Gene3Di3.30.530.20. 1 hit.
InterProiIPR013538. Activator_of_Hsp90_ATPase.
IPR015310. AHSA1_N.
IPR023393. START-like_dom.
[Graphical view]
PfamiPF09229. Aha1_N. 1 hit.
PF08327. AHSA1. 1 hit.
[Graphical view]
SMARTiSM01000. Aha1_N. 1 hit.
[Graphical view]
SUPFAMiSSF103111. SSF103111. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N9S3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKWGQGDPR WIVEEREDGT NVNNWHWTER DATIWSKGKL RELLVGIAME
60 70 80 90 100
NEAGRCEISE LKQVEGEASC NSRKGKLIFF YEWNIKLAWK GTVKESGAKH
110 120 130 140 150
KGLIEIPSLS EENEINDTEV NVSKKKGDGE ILKDLMRTTG TAKVREALGE
160 170 180 190 200
YLKALKTEFT TGMILPTKAV ATQELTLQRK LNENKLQASP VALGVRIPTV
210 220 230 240 250
ALHLTELFDT TVEQLYSIFT VKELVQKFSK SPAVLEAERG GKFQMFDGNI
260 270 280 290 300
SGEYVELVTN RKIIMKWRCR NWPEEHYATV ELNFVPAPGQ TELQLDCKGV
310 320 330
PVCKEENMKF CWQKQHFEEI KGLLELTAQN A
Length:331
Mass (Da):37,648
Last modified:January 15, 2008 - v2
Checksum:i94C560599937A951
GO
Isoform 2 (identifier: Q8N9S3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: Missing.

Show »
Length:283
Mass (Da):32,016
Checksum:i7C894550ACFAD953
GO
Isoform 3 (identifier: Q8N9S3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     275-331: EHYATVELNFVPAPGQTELQLDCKGVPVCKEENMKFCWQKQHFEEIKGLLELTAQNA → ALGFFPRTLCNS

Show »
Length:286
Mass (Da):32,439
Checksum:i7E062BDAC2E59257
GO

Sequence cautioni

The sequence AAH38397.2 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti14 – 141E → A in AAH52829 (PubMed:15489334).Curated
Sequence conflicti29 – 291E → A in AAH52829 (PubMed:15489334).Curated
Sequence conflicti42 – 421E → G in BAC04256 (PubMed:15449545).Curated
Sequence conflicti327 – 3271T → A in AAH38397 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4848Missing in isoform 2. 2 PublicationsVSP_030572Add
BLAST
Alternative sequencei275 – 33157EHYAT…TAQNA → ALGFFPRTLCNS in isoform 3. 1 PublicationVSP_030573Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093945 mRNA. Translation: BAC04256.1.
AK035941 mRNA. Translation: BAC29251.1.
AK137116 mRNA. Translation: BAE23240.1.
AK154196 mRNA. Translation: BAE32431.1.
AK155265 mRNA. Translation: BAE33153.1.
AL672049 Genomic DNA. Translation: CAM16932.1.
AL672049 Genomic DNA. Translation: CAM16934.1.
BC038397 mRNA. Translation: AAH38397.2. Different initiation.
BC052829 mRNA. Translation: AAH52829.1.
BC064012 mRNA. Translation: AAH64012.1.
CCDSiCCDS24476.1. [Q8N9S3-1]
CCDS70149.1. [Q8N9S3-2]
RefSeqiNP_001277583.1. NM_001290654.1. [Q8N9S3-2]
NP_001277584.1. NM_001290655.1. [Q8N9S3-3]
NP_765979.3. NM_172391.4. [Q8N9S3-1]
UniGeneiMm.13148.

Genome annotation databases

EnsembliENSMUST00000020529; ENSMUSP00000020529; ENSMUSG00000020288. [Q8N9S3-1]
ENSMUST00000109539; ENSMUSP00000105166; ENSMUSG00000020288. [Q8N9S3-2]
GeneIDi268390.
KEGGimmu:268390.
UCSCiuc007ifb.2. mouse. [Q8N9S3-1]
uc056ykb.1. mouse. [Q8N9S3-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093945 mRNA. Translation: BAC04256.1.
AK035941 mRNA. Translation: BAC29251.1.
AK137116 mRNA. Translation: BAE23240.1.
AK154196 mRNA. Translation: BAE32431.1.
AK155265 mRNA. Translation: BAE33153.1.
AL672049 Genomic DNA. Translation: CAM16932.1.
AL672049 Genomic DNA. Translation: CAM16934.1.
BC038397 mRNA. Translation: AAH38397.2. Different initiation.
BC052829 mRNA. Translation: AAH52829.1.
BC064012 mRNA. Translation: AAH64012.1.
CCDSiCCDS24476.1. [Q8N9S3-1]
CCDS70149.1. [Q8N9S3-2]
RefSeqiNP_001277583.1. NM_001290654.1. [Q8N9S3-2]
NP_001277584.1. NM_001290655.1. [Q8N9S3-3]
NP_765979.3. NM_172391.4. [Q8N9S3-1]
UniGeneiMm.13148.

3D structure databases

ProteinModelPortaliQ8N9S3.
SMRiQ8N9S3. Positions 25-155, 197-321.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000020529.

PTM databases

iPTMnetiQ8N9S3.
PhosphoSiteiQ8N9S3.

Proteomic databases

EPDiQ8N9S3.
MaxQBiQ8N9S3.
PaxDbiQ8N9S3.
PRIDEiQ8N9S3.

Protocols and materials databases

DNASUi268390.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000020529; ENSMUSP00000020529; ENSMUSG00000020288. [Q8N9S3-1]
ENSMUST00000109539; ENSMUSP00000105166; ENSMUSG00000020288. [Q8N9S3-2]
GeneIDi268390.
KEGGimmu:268390.
UCSCiuc007ifb.2. mouse. [Q8N9S3-1]
uc056ykb.1. mouse. [Q8N9S3-3]

Organism-specific databases

CTDi130872.
MGIiMGI:1916133. Ahsa2.

Phylogenomic databases

eggNOGiKOG2936. Eukaryota.
COG5580. LUCA.
GeneTreeiENSGT00390000006429.
HOGENOMiHOG000242852.
HOVERGENiHBG065806.
InParanoidiQ8N9S3.
OMAiKESGEKH.
OrthoDBiEOG77DJ64.
PhylomeDBiQ8N9S3.
TreeFamiTF313680.

Miscellaneous databases

PROiQ8N9S3.
SOURCEiSearch...

Gene expression databases

BgeeiQ8N9S3.
ExpressionAtlasiQ8N9S3. baseline and differential.
GenevisibleiQ8N9S3. MM.

Family and domain databases

Gene3Di3.30.530.20. 1 hit.
InterProiIPR013538. Activator_of_Hsp90_ATPase.
IPR015310. AHSA1_N.
IPR023393. START-like_dom.
[Graphical view]
PfamiPF09229. Aha1_N. 1 hit.
PF08327. AHSA1. 1 hit.
[Graphical view]
SMARTiSM01000. Aha1_N. 1 hit.
[Graphical view]
SUPFAMiSSF103111. SSF103111. 1 hit.
ProtoNetiSearch...

Publicationsi

  1. "Prediction of the coding sequences of mouse homologues of FLJ genes: the complete nucleotide sequences of 110 mouse FLJ-homologous cDNAs identified by screening of terminal sequences of cDNA clones randomly sampled from size-fractionated libraries."
    Okazaki N., Kikuno R., Ohara R., Inamoto S., Koseki H., Hiraoka S., Saga Y., Kitamura H., Nakagawa T., Nagase T., Ohara O., Koga H.
    DNA Res. 11:127-135(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: C57BL/6J and NOD.
    Tissue: Cerebellum and Embryo.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    Strain: C57BL/6J.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Strain: C57BL/6NCr and Czech II.
    Tissue: Hematopoietic stem cell, Jaw, Limb and Mammary tumor.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver, Lung and Spleen.

Entry informationi

Entry nameiAHSA2_MOUSE
AccessioniPrimary (citable) accession number: Q8N9S3
Secondary accession number(s): Q0P626
, Q6P3F2, Q7TMW7, Q8CBI4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: June 8, 2016
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.