Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Activator of 90 kDa heat shock protein ATPase homolog 2

Gene

Ahsa2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Co-chaperone that stimulates HSP90 ATPase activity.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionChaperone
Biological processStress response

Names & Taxonomyi

Protein namesi
Recommended name:
Activator of 90 kDa heat shock protein ATPase homolog 2
Gene namesi
Name:Ahsa2
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 11

Organism-specific databases

MGIiMGI:1916133 Ahsa2

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003156061 – 331Activator of 90 kDa heat shock protein ATPase homolog 2Add BLAST331

Proteomic databases

EPDiQ8N9S3
PaxDbiQ8N9S3
PRIDEiQ8N9S3

PTM databases

iPTMnetiQ8N9S3
PhosphoSitePlusiQ8N9S3

Expressioni

Gene expression databases

BgeeiENSMUSG00000020288
ExpressionAtlasiQ8N9S3 baseline and differential
GenevisibleiQ8N9S3 MM

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000020529

Structurei

3D structure databases

ProteinModelPortaliQ8N9S3
SMRiQ8N9S3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AHA1 family.Curated

Phylogenomic databases

eggNOGiKOG2936 Eukaryota
COG5580 LUCA
GeneTreeiENSGT00390000006429
HOGENOMiHOG000242852
HOVERGENiHBG065806
InParanoidiQ8N9S3
OMAiVMKWRCR
OrthoDBiEOG091G0BRP
PhylomeDBiQ8N9S3
TreeFamiTF313680

Family and domain databases

Gene3Di3.15.10.20, 1 hit
3.30.530.20, 1 hit
InterProiView protein in InterPro
IPR013538 Activator_of_Hsp90_ATPase
IPR036338 Aha1
IPR015310 AHSA1_N
IPR023393 START-like_dom_sf
PfamiView protein in Pfam
PF09229 Aha1_N, 1 hit
PF08327 AHSA1, 1 hit
SMARTiView protein in SMART
SM01000 Aha1_N, 1 hit
SUPFAMiSSF103111 SSF103111, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N9S3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKWGQGDPR WIVEEREDGT NVNNWHWTER DATIWSKGKL RELLVGIAME
60 70 80 90 100
NEAGRCEISE LKQVEGEASC NSRKGKLIFF YEWNIKLAWK GTVKESGAKH
110 120 130 140 150
KGLIEIPSLS EENEINDTEV NVSKKKGDGE ILKDLMRTTG TAKVREALGE
160 170 180 190 200
YLKALKTEFT TGMILPTKAV ATQELTLQRK LNENKLQASP VALGVRIPTV
210 220 230 240 250
ALHLTELFDT TVEQLYSIFT VKELVQKFSK SPAVLEAERG GKFQMFDGNI
260 270 280 290 300
SGEYVELVTN RKIIMKWRCR NWPEEHYATV ELNFVPAPGQ TELQLDCKGV
310 320 330
PVCKEENMKF CWQKQHFEEI KGLLELTAQN A
Length:331
Mass (Da):37,648
Last modified:January 15, 2008 - v2
Checksum:i94C560599937A951
GO
Isoform 2 (identifier: Q8N9S3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: Missing.

Show »
Length:283
Mass (Da):32,016
Checksum:i7C894550ACFAD953
GO
Isoform 3 (identifier: Q8N9S3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     275-331: EHYATVELNFVPAPGQTELQLDCKGVPVCKEENMKFCWQKQHFEEIKGLLELTAQNA → ALGFFPRTLCNS

Show »
Length:286
Mass (Da):32,439
Checksum:i7E062BDAC2E59257
GO

Sequence cautioni

The sequence AAH38397 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti14E → A in AAH52829 (PubMed:15489334).Curated1
Sequence conflicti29E → A in AAH52829 (PubMed:15489334).Curated1
Sequence conflicti42E → G in BAC04256 (PubMed:15449545).Curated1
Sequence conflicti327T → A in AAH38397 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0305721 – 48Missing in isoform 2. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_030573275 – 331EHYAT…TAQNA → ALGFFPRTLCNS in isoform 3. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK093945 mRNA Translation: BAC04256.1
AK035941 mRNA Translation: BAC29251.1
AK137116 mRNA Translation: BAE23240.1
AK154196 mRNA Translation: BAE32431.1
AK155265 mRNA Translation: BAE33153.1
AL672049 Genomic DNA Translation: CAM16932.1
AL672049 Genomic DNA Translation: CAM16934.1
BC038397 mRNA Translation: AAH38397.2 Different initiation.
BC052829 mRNA Translation: AAH52829.1
BC064012 mRNA Translation: AAH64012.1
CCDSiCCDS24476.1 [Q8N9S3-1]
CCDS70149.1 [Q8N9S3-2]
RefSeqiNP_001277583.1, NM_001290654.1 [Q8N9S3-2]
NP_001277584.1, NM_001290655.1 [Q8N9S3-3]
NP_765979.3, NM_172391.4 [Q8N9S3-1]
UniGeneiMm.13148

Genome annotation databases

EnsembliENSMUST00000020529; ENSMUSP00000020529; ENSMUSG00000020288 [Q8N9S3-1]
ENSMUST00000109539; ENSMUSP00000105166; ENSMUSG00000020288 [Q8N9S3-2]
GeneIDi268390
KEGGimmu:268390
UCSCiuc007ifb.2 mouse [Q8N9S3-1]
uc056ykb.1 mouse [Q8N9S3-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiAHSA2_MOUSE
AccessioniPrimary (citable) accession number: Q8N9S3
Secondary accession number(s): Q0P626
, Q6P3F2, Q7TMW7, Q8CBI4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: January 15, 2008
Last modified: March 28, 2018
This is version 100 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health