Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8N9L1 (ZIC4_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 104. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein ZIC 4
Alternative name(s):
Zinc finger protein of the cerebellum 4
Gene names
Name:ZIC4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length334 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Binds to DNA By similarity.

Subcellular location

Nucleus By similarity.

Sequence similarities

Belongs to the GLI C2H2-type zinc-finger protein family.

Contains 5 C2H2-type zinc fingers.

Caution

It is uncertain whether Met-1 is the initiator.

Sequence caution

The sequence AAH29507.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence starting in position 229.

The sequence AAK06845.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Keywords
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   DomainRepeat
Zinc-finger
   LigandDNA-binding
Metal-binding
Zinc
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentnucleus

Inferred from sequence or structural similarity. Source: UniProtKB

   Molecular_functionDNA binding

Inferred from sequence or structural similarity. Source: UniProtKB

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8N9L1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8N9L1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     231-256: EKPFRCEFEGCERRFANSSDRKKHSH → QYSALSVACGPSGEAGPRVWISSSPN
     257-334: Missing.
Note: May be due to an intron retention. No experimental confirmation available.
Isoform 3 (identifier: Q8N9L1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPPFCRNAKLGLLSFLICAGRSLLPLGKNAFWLERIENNNTLWEKAQSQKM
Note: No experimental confirmation available.
Isoform 4 (identifier: Q8N9L1-4)

The sequence of this isoform differs from the canonical sequence as follows:
     25-230: Missing.
Note: No experimental confirmation available.
Isoform 5 (identifier: Q8N9L1-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNGPCQSLRKAEGLLEGCTSAVTVFRKLPLDSKAQSQKM
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 334334Zinc finger protein ZIC 4
PRO_0000047253

Regions

Zinc finger128 – 16235C2H2-type 1; atypical
Zinc finger171 – 19828C2H2-type 2; atypical
Zinc finger204 – 22825C2H2-type 3
Zinc finger234 – 25825C2H2-type 4
Zinc finger264 – 28825C2H2-type 5
Compositional bias23 – 275Poly-Ser
Compositional bias88 – 947Poly-Ala

Natural variations

Alternative sequence11M → MPPFCRNAKLGLLSFLICAG RSLLPLGKNAFWLERIENNN TLWEKAQSQKM in isoform 3.
VSP_044484
Alternative sequence11M → MNGPCQSLRKAEGLLEGCTS AVTVFRKLPLDSKAQSQKM in isoform 5.
VSP_046072
Alternative sequence25 – 230206Missing in isoform 4.
VSP_045529
Alternative sequence231 – 25626EKPFR…KKHSH → QYSALSVACGPSGEAGPRVW ISSSPN in isoform 2.
VSP_017066
Alternative sequence257 – 33478Missing in isoform 2.
VSP_017067

Experimental info

Sequence conflict1001G → V in BAG57350. Ref.1
Sequence conflict2281H → Q in AAH29507. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 24, 2006. Version 3.
Checksum: 9EFEA2447D7B2F64

FASTA33436,567
        10         20         30         40         50         60 
MRYKTSLVMR KRLRLYRNTL KESSSSSGHH GPQLTAASSP SVFPGLHEEP PQASPSRPLN 

        70         80         90        100        110        120 
GLLRLGLPGD MYARPEPFPP GPAARSDALA AAAALHGYGG MNLTVNLAAP HGPGAFFRYM 

       130        140        150        160        170        180 
RQPIKQELIC KWLAADGTAT PSLCSKTFST MHELVTHVTV EHVGGPEQAN HICFWEECPR 

       190        200        210        220        230        240 
QGKPFKAKYK LVNHIRVHTG EKPFPCPFPG CGKVFARSEN LKIHKRTHTG EKPFRCEFEG 

       250        260        270        280        290        300 
CERRFANSSD RKKHSHVHTS DKPYTCKVRG CDKCYTHPSS LRKHMKVHGR SPPPSSGYDS 

       310        320        330 
ATPSALVSPS SDCGHKSQVA SSAAVAARTA DLSE 

« Hide

Isoform 2 [UniParc].

Checksum: C75BDAAD918C8BFE
Show »

FASTA25627,838
Isoform 3 [UniParc].

Checksum: 40BD96F45E1B4F47
Show »

FASTA38442,267
Isoform 4 [UniParc].

Checksum: D149681B97FCA014
Show »

FASTA12814,362
Isoform 5 [UniParc].

Checksum: B63E4DACB096BE02
Show »

FASTA37240,641

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
Tissue: Brain and Cerebellum.
[2]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[4]Warder D.E.
Submitted (DEC-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 25-334 (ISOFORM 2).
Tissue: Medulloblastoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK056262 mRNA. Translation: BAG51660.1.
AK094286 mRNA. Translation: BAC04322.1.
AK293981 mRNA. Translation: BAG57350.1.
AK294831 mRNA. Translation: BAH11898.1.
DA218617 mRNA. No translation available.
AC092959 Genomic DNA. No translation available.
BC029507 mRNA. Translation: AAH29507.1. Sequence problems.
BC126267 mRNA. Translation: AAI26268.1.
BC136339 mRNA. Translation: AAI36340.1.
AF332509 mRNA. Translation: AAK06845.1. Different initiation.
RefSeqNP_001161850.1. NM_001168378.1.
NP_001161851.1. NM_001168379.1.
NP_001230185.1. NM_001243256.1.
NP_115529.2. NM_032153.5.
UniGeneHs.415766.
Hs.739084.

3D structure databases

ProteinModelPortalQ8N9L1.
SMRQ8N9L1. Positions 122-289.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ8N9L1. 1 interaction.
STRING9606.ENSP00000372553.

PTM databases

PhosphoSiteQ8N9L1.

Polymorphism databases

DMDM85700440.

Proteomic databases

PaxDbQ8N9L1.
PRIDEQ8N9L1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000383075; ENSP00000372553; ENSG00000174963. [Q8N9L1-1]
ENST00000425731; ENSP00000397695; ENSG00000174963. [Q8N9L1-5]
ENST00000473123; ENSP00000420775; ENSG00000174963. [Q8N9L1-1]
ENST00000484399; ENSP00000417855; ENSG00000174963. [Q8N9L1-1]
ENST00000491672; ENSP00000418277; ENSG00000174963. [Q8N9L1-4]
ENST00000525172; ENSP00000435509; ENSG00000174963. [Q8N9L1-3]
GeneID84107.
KEGGhsa:84107.
UCSCuc003ewc.2. human. [Q8N9L1-1]
uc011bno.2. human. [Q8N9L1-3]

Organism-specific databases

CTD84107.
GeneCardsGC03M147103.
HGNCHGNC:20393. ZIC4.
HPACAB022615.
MIM608948. gene.
neXtProtNX_Q8N9L1.
Orphanet217. Isolated Dandy-Walker malformation.
PharmGKBPA134937175.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOGENOMHOG000232057.
HOVERGENHBG007135.
InParanoidQ8N9L1.
KOK09225.
OMAPSSDCGH.
OrthoDBEOG76472R.
PhylomeDBQ8N9L1.
TreeFamTF351425.

Gene expression databases

ArrayExpressQ8N9L1.
BgeeQ8N9L1.
CleanExHS_ZIC4.
GenevestigatorQ8N9L1.

Family and domain databases

Gene3D3.30.160.60. 4 hits.
InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi84107.
NextBio35535333.
PROQ8N9L1.
SOURCESearch...

Entry information

Entry nameZIC4_HUMAN
AccessionPrimary (citable) accession number: Q8N9L1
Secondary accession number(s): A0AVA2 expand/collapse secondary AC list , B2RMQ8, B4DF89, B7Z2L2, C9J7D5, J3KQG1, Q4G157, Q9BZ94
Entry history
Integrated into UniProtKB/Swiss-Prot: February 22, 2003
Last sequence update: January 24, 2006
Last modified: March 19, 2014
This is version 104 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM