Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein ZIC 4

Gene

ZIC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Binds to DNA.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri128 – 16235C2H2-type 1; atypicalPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri171 – 19828C2H2-type 2; atypicalPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri204 – 22825C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri234 – 25825C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri264 – 28825C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein ZIC 4
Alternative name(s):
Zinc finger protein of the cerebellum 4
Gene namesi
Name:ZIC4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:20393. ZIC4.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

Orphaneti269212. Isolated Dandy-Walker malformation with hydrocephalus.
269215. Isolated Dandy-Walker malformation without hydrocephalus.
PharmGKBiPA134937175.

Polymorphism and mutation databases

BioMutaiZIC4.
DMDMi85700440.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 334334Zinc finger protein ZIC 4PRO_0000047253Add
BLAST

Proteomic databases

PaxDbiQ8N9L1.
PRIDEiQ8N9L1.

PTM databases

PhosphoSiteiQ8N9L1.

Expressioni

Gene expression databases

BgeeiQ8N9L1.
CleanExiHS_ZIC4.
ExpressionAtlasiQ8N9L1. baseline and differential.
GenevestigatoriQ8N9L1.

Organism-specific databases

HPAiHPA030194.

Interactioni

Protein-protein interaction databases

IntActiQ8N9L1. 1 interaction.
STRINGi9606.ENSP00000372553.

Structurei

3D structure databases

ProteinModelPortaliQ8N9L1.
SMRiQ8N9L1. Positions 122-289.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi23 – 275Poly-Ser
Compositional biasi88 – 947Poly-Ala

Sequence similaritiesi

Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri128 – 16235C2H2-type 1; atypicalPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri171 – 19828C2H2-type 2; atypicalPROSITE-ProRule annotationAdd
BLAST
Zinc fingeri204 – 22825C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri234 – 25825C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri264 – 28825C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00760000118771.
HOGENOMiHOG000232057.
HOVERGENiHBG007135.
InParanoidiQ8N9L1.
KOiK09225.
OMAiPSSDFGR.
OrthoDBiEOG76472R.
PhylomeDBiQ8N9L1.
TreeFamiTF351425.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N9L1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRYKTSLVMR KRLRLYRNTL KESSSSSGHH GPQLTAASSP SVFPGLHEEP
60 70 80 90 100
PQASPSRPLN GLLRLGLPGD MYARPEPFPP GPAARSDALA AAAALHGYGG
110 120 130 140 150
MNLTVNLAAP HGPGAFFRYM RQPIKQELIC KWLAADGTAT PSLCSKTFST
160 170 180 190 200
MHELVTHVTV EHVGGPEQAN HICFWEECPR QGKPFKAKYK LVNHIRVHTG
210 220 230 240 250
EKPFPCPFPG CGKVFARSEN LKIHKRTHTG EKPFRCEFEG CERRFANSSD
260 270 280 290 300
RKKHSHVHTS DKPYTCKVRG CDKCYTHPSS LRKHMKVHGR SPPPSSGYDS
310 320 330
ATPSALVSPS SDCGHKSQVA SSAAVAARTA DLSE
Length:334
Mass (Da):36,567
Last modified:January 24, 2006 - v3
Checksum:i9EFEA2447D7B2F64
GO
Isoform 2 (identifier: Q8N9L1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     231-256: EKPFRCEFEGCERRFANSSDRKKHSH → QYSALSVACGPSGEAGPRVWISSSPN
     257-334: Missing.

Note: May be due to an intron retention. No experimental confirmation available.

Show »
Length:256
Mass (Da):27,838
Checksum:iC75BDAAD918C8BFE
GO
Isoform 3 (identifier: Q8N9L1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPPFCRNAKLGLLSFLICAGRSLLPLGKNAFWLERIENNNTLWEKAQSQKM

Note: No experimental confirmation available.

Show »
Length:384
Mass (Da):42,267
Checksum:i40BD96F45E1B4F47
GO
Isoform 4 (identifier: Q8N9L1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-230: Missing.

Note: No experimental confirmation available.

Show »
Length:128
Mass (Da):14,362
Checksum:iD149681B97FCA014
GO
Isoform 5 (identifier: Q8N9L1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNGPCQSLRKAEGLLEGCTSAVTVFRKLPLDSKAQSQKM

Note: No experimental confirmation available.

Show »
Length:372
Mass (Da):40,641
Checksum:iB63E4DACB096BE02
GO

Sequence cautioni

The sequence AAH29507.1 differs from that shown.Contaminating sequence. Potential poly-A sequence starting in position 229.Curated
The sequence AAK06845.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti100 – 1001G → V in BAG57350 (PubMed:14702039).Curated
Sequence conflicti228 – 2281H → Q in AAH29507 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MPPFCRNAKLGLLSFLICAG RSLLPLGKNAFWLERIENNN TLWEKAQSQKM in isoform 3. 1 PublicationVSP_044484
Alternative sequencei1 – 11M → MNGPCQSLRKAEGLLEGCTS AVTVFRKLPLDSKAQSQKM in isoform 5. 1 PublicationVSP_046072
Alternative sequencei25 – 230206Missing in isoform 4. 1 PublicationVSP_045529Add
BLAST
Alternative sequencei231 – 25626EKPFR…KKHSH → QYSALSVACGPSGEAGPRVW ISSSPN in isoform 2. 1 PublicationVSP_017066Add
BLAST
Alternative sequencei257 – 33478Missing in isoform 2. 1 PublicationVSP_017067Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056262 mRNA. Translation: BAG51660.1.
AK094286 mRNA. Translation: BAC04322.1.
AK293981 mRNA. Translation: BAG57350.1.
AK294831 mRNA. Translation: BAH11898.1.
DA218617 mRNA. No translation available.
AC092959 Genomic DNA. No translation available.
BC029507 mRNA. Translation: AAH29507.1. Sequence problems.
BC126267 mRNA. Translation: AAI26268.1.
BC136339 mRNA. Translation: AAI36340.1.
AF332509 mRNA. Translation: AAK06845.1. Different initiation.
CCDSiCCDS43160.1. [Q8N9L1-1]
CCDS54652.1. [Q8N9L1-3]
CCDS54653.1. [Q8N9L1-5]
CCDS58857.1. [Q8N9L1-4]
RefSeqiNP_001161850.1. NM_001168378.1. [Q8N9L1-3]
NP_001161851.1. NM_001168379.1. [Q8N9L1-5]
NP_001230185.1. NM_001243256.1. [Q8N9L1-4]
NP_115529.2. NM_032153.5. [Q8N9L1-1]
UniGeneiHs.415766.
Hs.739084.

Genome annotation databases

EnsembliENST00000383075; ENSP00000372553; ENSG00000174963. [Q8N9L1-1]
ENST00000425731; ENSP00000397695; ENSG00000174963. [Q8N9L1-5]
ENST00000473123; ENSP00000420775; ENSG00000174963. [Q8N9L1-1]
ENST00000484399; ENSP00000417855; ENSG00000174963. [Q8N9L1-1]
ENST00000491672; ENSP00000418277; ENSG00000174963. [Q8N9L1-4]
ENST00000525172; ENSP00000435509; ENSG00000174963. [Q8N9L1-3]
GeneIDi84107.
KEGGihsa:84107.
UCSCiuc003ewc.2. human. [Q8N9L1-1]
uc011bno.2. human. [Q8N9L1-3]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056262 mRNA. Translation: BAG51660.1.
AK094286 mRNA. Translation: BAC04322.1.
AK293981 mRNA. Translation: BAG57350.1.
AK294831 mRNA. Translation: BAH11898.1.
DA218617 mRNA. No translation available.
AC092959 Genomic DNA. No translation available.
BC029507 mRNA. Translation: AAH29507.1. Sequence problems.
BC126267 mRNA. Translation: AAI26268.1.
BC136339 mRNA. Translation: AAI36340.1.
AF332509 mRNA. Translation: AAK06845.1. Different initiation.
CCDSiCCDS43160.1. [Q8N9L1-1]
CCDS54652.1. [Q8N9L1-3]
CCDS54653.1. [Q8N9L1-5]
CCDS58857.1. [Q8N9L1-4]
RefSeqiNP_001161850.1. NM_001168378.1. [Q8N9L1-3]
NP_001161851.1. NM_001168379.1. [Q8N9L1-5]
NP_001230185.1. NM_001243256.1. [Q8N9L1-4]
NP_115529.2. NM_032153.5. [Q8N9L1-1]
UniGeneiHs.415766.
Hs.739084.

3D structure databases

ProteinModelPortaliQ8N9L1.
SMRiQ8N9L1. Positions 122-289.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8N9L1. 1 interaction.
STRINGi9606.ENSP00000372553.

PTM databases

PhosphoSiteiQ8N9L1.

Polymorphism and mutation databases

BioMutaiZIC4.
DMDMi85700440.

Proteomic databases

PaxDbiQ8N9L1.
PRIDEiQ8N9L1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000383075; ENSP00000372553; ENSG00000174963. [Q8N9L1-1]
ENST00000425731; ENSP00000397695; ENSG00000174963. [Q8N9L1-5]
ENST00000473123; ENSP00000420775; ENSG00000174963. [Q8N9L1-1]
ENST00000484399; ENSP00000417855; ENSG00000174963. [Q8N9L1-1]
ENST00000491672; ENSP00000418277; ENSG00000174963. [Q8N9L1-4]
ENST00000525172; ENSP00000435509; ENSG00000174963. [Q8N9L1-3]
GeneIDi84107.
KEGGihsa:84107.
UCSCiuc003ewc.2. human. [Q8N9L1-1]
uc011bno.2. human. [Q8N9L1-3]

Organism-specific databases

CTDi84107.
GeneCardsiGC03M147103.
HGNCiHGNC:20393. ZIC4.
HPAiHPA030194.
MIMi608948. gene.
neXtProtiNX_Q8N9L1.
Orphaneti269212. Isolated Dandy-Walker malformation with hydrocephalus.
269215. Isolated Dandy-Walker malformation without hydrocephalus.
PharmGKBiPA134937175.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00760000118771.
HOGENOMiHOG000232057.
HOVERGENiHBG007135.
InParanoidiQ8N9L1.
KOiK09225.
OMAiPSSDFGR.
OrthoDBiEOG76472R.
PhylomeDBiQ8N9L1.
TreeFamiTF351425.

Miscellaneous databases

GenomeRNAii84107.
NextBioi35535333.
PROiQ8N9L1.
SOURCEiSearch...

Gene expression databases

BgeeiQ8N9L1.
CleanExiHS_ZIC4.
ExpressionAtlasiQ8N9L1. baseline and differential.
GenevestigatoriQ8N9L1.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
    Tissue: Brain and Cerebellum.
  2. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. Warder D.E.
    Submitted (DEC-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 25-334 (ISOFORM 2).
    Tissue: Medulloblastoma.

Entry informationi

Entry nameiZIC4_HUMAN
AccessioniPrimary (citable) accession number: Q8N9L1
Secondary accession number(s): A0AVA2
, B2RMQ8, B4DF89, B7Z2L2, C9J7D5, J3KQG1, Q4G157, Q9BZ94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 22, 2003
Last sequence update: January 24, 2006
Last modified: April 29, 2015
This is version 112 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

It is uncertain whether Met-1 is the initiator.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.