Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8N9L1

- ZIC4_HUMAN

UniProt

Q8N9L1 - ZIC4_HUMAN

Protein

Zinc finger protein ZIC 4

Gene

ZIC4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 108 (01 Oct 2014)
      Sequence version 3 (24 Jan 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Binds to DNA.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri128 – 16235C2H2-type 1; atypicalPROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri171 – 19828C2H2-type 2; atypicalPROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri204 – 22825C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri234 – 25825C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri264 – 28825C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB
    2. metal ion binding Source: UniProtKB-KW

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein ZIC 4
    Alternative name(s):
    Zinc finger protein of the cerebellum 4
    Gene namesi
    Name:ZIC4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:20393. ZIC4.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    Orphaneti269212. Isolated Dandy-Walker malformation with hydrocephalus.
    269215. Isolated Dandy-Walker malformation without hydrocephalus.
    PharmGKBiPA134937175.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 334334Zinc finger protein ZIC 4PRO_0000047253Add
    BLAST

    Proteomic databases

    PaxDbiQ8N9L1.
    PRIDEiQ8N9L1.

    PTM databases

    PhosphoSiteiQ8N9L1.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8N9L1.
    BgeeiQ8N9L1.
    CleanExiHS_ZIC4.
    GenevestigatoriQ8N9L1.

    Organism-specific databases

    HPAiCAB022615.

    Interactioni

    Protein-protein interaction databases

    IntActiQ8N9L1. 1 interaction.
    STRINGi9606.ENSP00000372553.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8N9L1.
    SMRiQ8N9L1. Positions 122-289.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi23 – 275Poly-Ser
    Compositional biasi88 – 947Poly-Ala

    Sequence similaritiesi

    Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri128 – 16235C2H2-type 1; atypicalPROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri171 – 19828C2H2-type 2; atypicalPROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri204 – 22825C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri234 – 25825C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri264 – 28825C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOGENOMiHOG000232057.
    HOVERGENiHBG007135.
    InParanoidiQ8N9L1.
    KOiK09225.
    OMAiPSSDCGH.
    OrthoDBiEOG76472R.
    PhylomeDBiQ8N9L1.
    TreeFamiTF351425.

    Family and domain databases

    Gene3Di3.30.160.60. 4 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF00096. zf-C2H2. 1 hit.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 5 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 4 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8N9L1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRYKTSLVMR KRLRLYRNTL KESSSSSGHH GPQLTAASSP SVFPGLHEEP    50
    PQASPSRPLN GLLRLGLPGD MYARPEPFPP GPAARSDALA AAAALHGYGG 100
    MNLTVNLAAP HGPGAFFRYM RQPIKQELIC KWLAADGTAT PSLCSKTFST 150
    MHELVTHVTV EHVGGPEQAN HICFWEECPR QGKPFKAKYK LVNHIRVHTG 200
    EKPFPCPFPG CGKVFARSEN LKIHKRTHTG EKPFRCEFEG CERRFANSSD 250
    RKKHSHVHTS DKPYTCKVRG CDKCYTHPSS LRKHMKVHGR SPPPSSGYDS 300
    ATPSALVSPS SDCGHKSQVA SSAAVAARTA DLSE 334
    Length:334
    Mass (Da):36,567
    Last modified:January 24, 2006 - v3
    Checksum:i9EFEA2447D7B2F64
    GO
    Isoform 2 (identifier: Q8N9L1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         231-256: EKPFRCEFEGCERRFANSSDRKKHSH → QYSALSVACGPSGEAGPRVWISSSPN
         257-334: Missing.

    Note: May be due to an intron retention. No experimental confirmation available.

    Show »
    Length:256
    Mass (Da):27,838
    Checksum:iC75BDAAD918C8BFE
    GO
    Isoform 3 (identifier: Q8N9L1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MPPFCRNAKLGLLSFLICAGRSLLPLGKNAFWLERIENNNTLWEKAQSQKM

    Note: No experimental confirmation available.

    Show »
    Length:384
    Mass (Da):42,267
    Checksum:i40BD96F45E1B4F47
    GO
    Isoform 4 (identifier: Q8N9L1-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         25-230: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:128
    Mass (Da):14,362
    Checksum:iD149681B97FCA014
    GO
    Isoform 5 (identifier: Q8N9L1-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MNGPCQSLRKAEGLLEGCTSAVTVFRKLPLDSKAQSQKM

    Note: No experimental confirmation available.

    Show »
    Length:372
    Mass (Da):40,641
    Checksum:iB63E4DACB096BE02
    GO

    Sequence cautioni

    The sequence AAH29507.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence starting in position 229.
    The sequence AAK06845.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti100 – 1001G → V in BAG57350. (PubMed:14702039)Curated
    Sequence conflicti228 – 2281H → Q in AAH29507. (PubMed:15489334)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MPPFCRNAKLGLLSFLICAG RSLLPLGKNAFWLERIENNN TLWEKAQSQKM in isoform 3. 1 PublicationVSP_044484
    Alternative sequencei1 – 11M → MNGPCQSLRKAEGLLEGCTS AVTVFRKLPLDSKAQSQKM in isoform 5. 1 PublicationVSP_046072
    Alternative sequencei25 – 230206Missing in isoform 4. 1 PublicationVSP_045529Add
    BLAST
    Alternative sequencei231 – 25626EKPFR…KKHSH → QYSALSVACGPSGEAGPRVW ISSSPN in isoform 2. 1 PublicationVSP_017066Add
    BLAST
    Alternative sequencei257 – 33478Missing in isoform 2. 1 PublicationVSP_017067Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056262 mRNA. Translation: BAG51660.1.
    AK094286 mRNA. Translation: BAC04322.1.
    AK293981 mRNA. Translation: BAG57350.1.
    AK294831 mRNA. Translation: BAH11898.1.
    DA218617 mRNA. No translation available.
    AC092959 Genomic DNA. No translation available.
    BC029507 mRNA. Translation: AAH29507.1. Sequence problems.
    BC126267 mRNA. Translation: AAI26268.1.
    BC136339 mRNA. Translation: AAI36340.1.
    AF332509 mRNA. Translation: AAK06845.1. Different initiation.
    CCDSiCCDS43160.1. [Q8N9L1-1]
    CCDS54652.1. [Q8N9L1-3]
    CCDS54653.1. [Q8N9L1-5]
    CCDS58857.1. [Q8N9L1-4]
    RefSeqiNP_001161850.1. NM_001168378.1. [Q8N9L1-3]
    NP_001161851.1. NM_001168379.1. [Q8N9L1-5]
    NP_001230185.1. NM_001243256.1. [Q8N9L1-4]
    NP_115529.2. NM_032153.5. [Q8N9L1-1]
    UniGeneiHs.415766.
    Hs.739084.

    Genome annotation databases

    EnsembliENST00000383075; ENSP00000372553; ENSG00000174963. [Q8N9L1-1]
    ENST00000425731; ENSP00000397695; ENSG00000174963. [Q8N9L1-5]
    ENST00000473123; ENSP00000420775; ENSG00000174963. [Q8N9L1-1]
    ENST00000484399; ENSP00000417855; ENSG00000174963. [Q8N9L1-1]
    ENST00000491672; ENSP00000418277; ENSG00000174963. [Q8N9L1-4]
    ENST00000525172; ENSP00000435509; ENSG00000174963. [Q8N9L1-3]
    GeneIDi84107.
    KEGGihsa:84107.
    UCSCiuc003ewc.2. human. [Q8N9L1-1]
    uc011bno.2. human. [Q8N9L1-3]

    Polymorphism databases

    DMDMi85700440.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK056262 mRNA. Translation: BAG51660.1 .
    AK094286 mRNA. Translation: BAC04322.1 .
    AK293981 mRNA. Translation: BAG57350.1 .
    AK294831 mRNA. Translation: BAH11898.1 .
    DA218617 mRNA. No translation available.
    AC092959 Genomic DNA. No translation available.
    BC029507 mRNA. Translation: AAH29507.1 . Sequence problems.
    BC126267 mRNA. Translation: AAI26268.1 .
    BC136339 mRNA. Translation: AAI36340.1 .
    AF332509 mRNA. Translation: AAK06845.1 . Different initiation.
    CCDSi CCDS43160.1. [Q8N9L1-1 ]
    CCDS54652.1. [Q8N9L1-3 ]
    CCDS54653.1. [Q8N9L1-5 ]
    CCDS58857.1. [Q8N9L1-4 ]
    RefSeqi NP_001161850.1. NM_001168378.1. [Q8N9L1-3 ]
    NP_001161851.1. NM_001168379.1. [Q8N9L1-5 ]
    NP_001230185.1. NM_001243256.1. [Q8N9L1-4 ]
    NP_115529.2. NM_032153.5. [Q8N9L1-1 ]
    UniGenei Hs.415766.
    Hs.739084.

    3D structure databases

    ProteinModelPortali Q8N9L1.
    SMRi Q8N9L1. Positions 122-289.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q8N9L1. 1 interaction.
    STRINGi 9606.ENSP00000372553.

    PTM databases

    PhosphoSitei Q8N9L1.

    Polymorphism databases

    DMDMi 85700440.

    Proteomic databases

    PaxDbi Q8N9L1.
    PRIDEi Q8N9L1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000383075 ; ENSP00000372553 ; ENSG00000174963 . [Q8N9L1-1 ]
    ENST00000425731 ; ENSP00000397695 ; ENSG00000174963 . [Q8N9L1-5 ]
    ENST00000473123 ; ENSP00000420775 ; ENSG00000174963 . [Q8N9L1-1 ]
    ENST00000484399 ; ENSP00000417855 ; ENSG00000174963 . [Q8N9L1-1 ]
    ENST00000491672 ; ENSP00000418277 ; ENSG00000174963 . [Q8N9L1-4 ]
    ENST00000525172 ; ENSP00000435509 ; ENSG00000174963 . [Q8N9L1-3 ]
    GeneIDi 84107.
    KEGGi hsa:84107.
    UCSCi uc003ewc.2. human. [Q8N9L1-1 ]
    uc011bno.2. human. [Q8N9L1-3 ]

    Organism-specific databases

    CTDi 84107.
    GeneCardsi GC03M147103.
    HGNCi HGNC:20393. ZIC4.
    HPAi CAB022615.
    MIMi 608948. gene.
    neXtProti NX_Q8N9L1.
    Orphaneti 269212. Isolated Dandy-Walker malformation with hydrocephalus.
    269215. Isolated Dandy-Walker malformation without hydrocephalus.
    PharmGKBi PA134937175.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOGENOMi HOG000232057.
    HOVERGENi HBG007135.
    InParanoidi Q8N9L1.
    KOi K09225.
    OMAi PSSDCGH.
    OrthoDBi EOG76472R.
    PhylomeDBi Q8N9L1.
    TreeFami TF351425.

    Miscellaneous databases

    GenomeRNAii 84107.
    NextBioi 35535333.
    PROi Q8N9L1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q8N9L1.
    Bgeei Q8N9L1.
    CleanExi HS_ZIC4.
    Genevestigatori Q8N9L1.

    Family and domain databases

    Gene3Di 3.30.160.60. 4 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF00096. zf-C2H2. 1 hit.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 5 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 3 hits.
    PS50157. ZINC_FINGER_C2H2_2. 4 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
      Tissue: Brain and Cerebellum.
    2. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    4. Warder D.E.
      Submitted (DEC-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 25-334 (ISOFORM 2).
      Tissue: Medulloblastoma.

    Entry informationi

    Entry nameiZIC4_HUMAN
    AccessioniPrimary (citable) accession number: Q8N9L1
    Secondary accession number(s): A0AVA2
    , B2RMQ8, B4DF89, B7Z2L2, C9J7D5, J3KQG1, Q4G157, Q9BZ94
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 22, 2003
    Last sequence update: January 24, 2006
    Last modified: October 1, 2014
    This is version 108 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3