Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein ZIC 4

Gene

ZIC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Binds to DNA.By similarity

Caution

It is uncertain whether Met-1 is the initiator.Curated

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri128 – 162C2H2-type 1; atypicalPROSITE-ProRule annotationAdd BLAST35
Zinc fingeri171 – 198C2H2-type 2; atypicalPROSITE-ProRule annotationAdd BLAST28
Zinc fingeri204 – 228C2H2-type 3PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri234 – 258C2H2-type 4PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri264 – 288C2H2-type 5PROSITE-ProRule annotationAdd BLAST25

GO - Molecular functioni

Keywordsi

Molecular functionDNA-binding
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein ZIC 4
Alternative name(s):
Zinc finger protein of the cerebellum 4
Gene namesi
Name:ZIC4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi

Organism-specific databases

EuPathDBiHostDB:ENSG00000174963.17
HGNCiHGNC:20393 ZIC4
MIMi608948 gene
neXtProtiNX_Q8N9L1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi84107
MalaCardsiZIC4
OpenTargetsiENSG00000174963
Orphaneti269212 Isolated Dandy-Walker malformation with hydrocephalus
269215 Isolated Dandy-Walker malformation without hydrocephalus
PharmGKBiPA134937175

Polymorphism and mutation databases

BioMutaiZIC4
DMDMi85700440

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000472531 – 334Zinc finger protein ZIC 4Add BLAST334

Proteomic databases

EPDiQ8N9L1
MaxQBiQ8N9L1
PaxDbiQ8N9L1
PeptideAtlasiQ8N9L1
PRIDEiQ8N9L1
TopDownProteomicsiQ8N9L1-3 [Q8N9L1-3]

PTM databases

iPTMnetiQ8N9L1
PhosphoSitePlusiQ8N9L1

Expressioni

Gene expression databases

BgeeiENSG00000174963
CleanExiHS_ZIC4
ExpressionAtlasiQ8N9L1 baseline and differential
GenevisibleiQ8N9L1 HS

Organism-specific databases

HPAiHPA030194

Interactioni

Protein-protein interaction databases

BioGridi123895, 1 interactor
IntActiQ8N9L1, 2 interactors
STRINGi9606.ENSP00000435509

Structurei

3D structure databases

ProteinModelPortaliQ8N9L1
SMRiQ8N9L1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi23 – 27Poly-Ser5
Compositional biasi88 – 94Poly-Ala7

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri128 – 162C2H2-type 1; atypicalPROSITE-ProRule annotationAdd BLAST35
Zinc fingeri171 – 198C2H2-type 2; atypicalPROSITE-ProRule annotationAdd BLAST28
Zinc fingeri204 – 228C2H2-type 3PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri234 – 258C2H2-type 4PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri264 – 288C2H2-type 5PROSITE-ProRule annotationAdd BLAST25

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00900000140802
HOGENOMiHOG000232057
HOVERGENiHBG007135
InParanoidiQ8N9L1
KOiK09225
OMAiPSSDFGR
OrthoDBiEOG091G0M59
PhylomeDBiQ8N9L1
TreeFamiTF351425

Family and domain databases

InterProiView protein in InterPro
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF57667 SSF57667, 2 hits
PROSITEiView protein in PROSITE
PS00028 ZINC_FINGER_C2H2_1, 3 hits
PS50157 ZINC_FINGER_C2H2_2, 4 hits

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N9L1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRYKTSLVMR KRLRLYRNTL KESSSSSGHH GPQLTAASSP SVFPGLHEEP
60 70 80 90 100
PQASPSRPLN GLLRLGLPGD MYARPEPFPP GPAARSDALA AAAALHGYGG
110 120 130 140 150
MNLTVNLAAP HGPGAFFRYM RQPIKQELIC KWLAADGTAT PSLCSKTFST
160 170 180 190 200
MHELVTHVTV EHVGGPEQAN HICFWEECPR QGKPFKAKYK LVNHIRVHTG
210 220 230 240 250
EKPFPCPFPG CGKVFARSEN LKIHKRTHTG EKPFRCEFEG CERRFANSSD
260 270 280 290 300
RKKHSHVHTS DKPYTCKVRG CDKCYTHPSS LRKHMKVHGR SPPPSSGYDS
310 320 330
ATPSALVSPS SDCGHKSQVA SSAAVAARTA DLSE
Length:334
Mass (Da):36,567
Last modified:January 24, 2006 - v3
Checksum:i9EFEA2447D7B2F64
GO
Isoform 2 (identifier: Q8N9L1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     231-256: EKPFRCEFEGCERRFANSSDRKKHSH → QYSALSVACGPSGEAGPRVWISSSPN
     257-334: Missing.

Note: May be due to an intron retention. No experimental confirmation available.
Show »
Length:256
Mass (Da):27,838
Checksum:iC75BDAAD918C8BFE
GO
Isoform 3 (identifier: Q8N9L1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPPFCRNAKLGLLSFLICAGRSLLPLGKNAFWLERIENNNTLWEKAQSQKM

Note: No experimental confirmation available.
Show »
Length:384
Mass (Da):42,267
Checksum:i40BD96F45E1B4F47
GO
Isoform 4 (identifier: Q8N9L1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-230: Missing.

Note: No experimental confirmation available.
Show »
Length:128
Mass (Da):14,362
Checksum:iD149681B97FCA014
GO
Isoform 5 (identifier: Q8N9L1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNGPCQSLRKAEGLLEGCTSAVTVFRKLPLDSKAQSQKM

Note: No experimental confirmation available.
Show »
Length:372
Mass (Da):40,641
Checksum:iB63E4DACB096BE02
GO

Sequence cautioni

The sequence AAH29507 differs from that shown. Contaminating sequence. Potential poly-A sequence starting in position 229.Curated
The sequence AAK06845 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti100G → V in BAG57350 (PubMed:14702039).Curated1
Sequence conflicti228H → Q in AAH29507 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0444841M → MPPFCRNAKLGLLSFLICAG RSLLPLGKNAFWLERIENNN TLWEKAQSQKM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0460721M → MNGPCQSLRKAEGLLEGCTS AVTVFRKLPLDSKAQSQKM in isoform 5. 1 Publication1
Alternative sequenceiVSP_04552925 – 230Missing in isoform 4. 1 PublicationAdd BLAST206
Alternative sequenceiVSP_017066231 – 256EKPFR…KKHSH → QYSALSVACGPSGEAGPRVW ISSSPN in isoform 2. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_017067257 – 334Missing in isoform 2. 1 PublicationAdd BLAST78

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056262 mRNA Translation: BAG51660.1
AK094286 mRNA Translation: BAC04322.1
AK293981 mRNA Translation: BAG57350.1
AK294831 mRNA Translation: BAH11898.1
DA218617 mRNA No translation available.
AC092959 Genomic DNA No translation available.
BC029507 mRNA Translation: AAH29507.1 Sequence problems.
BC126267 mRNA Translation: AAI26268.1
BC136339 mRNA Translation: AAI36340.1
AF332509 mRNA Translation: AAK06845.1 Different initiation.
CCDSiCCDS43160.1 [Q8N9L1-1]
CCDS54652.1 [Q8N9L1-3]
CCDS54653.1 [Q8N9L1-5]
CCDS58857.1 [Q8N9L1-4]
RefSeqiNP_001161850.1, NM_001168378.1 [Q8N9L1-3]
NP_001161851.1, NM_001168379.1 [Q8N9L1-5]
NP_001230185.1, NM_001243256.1 [Q8N9L1-4]
NP_115529.2, NM_032153.5 [Q8N9L1-1]
UniGeneiHs.415766
Hs.739084

Genome annotation databases

EnsembliENST00000383075; ENSP00000372553; ENSG00000174963 [Q8N9L1-1]
ENST00000425731; ENSP00000397695; ENSG00000174963 [Q8N9L1-5]
ENST00000473123; ENSP00000420775; ENSG00000174963 [Q8N9L1-1]
ENST00000484399; ENSP00000417855; ENSG00000174963 [Q8N9L1-1]
ENST00000491672; ENSP00000418277; ENSG00000174963 [Q8N9L1-4]
ENST00000525172; ENSP00000435509; ENSG00000174963 [Q8N9L1-3]
GeneIDi84107
KEGGihsa:84107
UCSCiuc003ewd.3 human [Q8N9L1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiZIC4_HUMAN
AccessioniPrimary (citable) accession number: Q8N9L1
Secondary accession number(s): A0AVA2
, B2RMQ8, B4DF89, B7Z2L2, C9J7D5, J3KQG1, Q4G157, Q9BZ94
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 22, 2003
Last sequence update: January 24, 2006
Last modified: May 23, 2018
This is version 136 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health