SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8N9L1

- ZIC4_HUMAN

UniProt

Q8N9L1 - ZIC4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Zinc finger protein ZIC 4
Gene
ZIC4
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Functioni

Binds to DNA By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri128 – 16235C2H2-type 1; atypical
Add
BLAST
Zinc fingeri171 – 19828C2H2-type 2; atypical
Add
BLAST
Zinc fingeri204 – 22825C2H2-type 3
Add
BLAST
Zinc fingeri234 – 25825C2H2-type 4
Add
BLAST
Zinc fingeri264 – 28825C2H2-type 5
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB
  2. metal ion binding Source: UniProtKB-KW
Complete GO annotation...

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein ZIC 4
Alternative name(s):
Zinc finger protein of the cerebellum 4
Gene namesi
Name:ZIC4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:20393. ZIC4.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

Orphaneti269212. Isolated Dandy-Walker malformation with hydrocephalus.
269215. Isolated Dandy-Walker malformation without hydrocephalus.
PharmGKBiPA134937175.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 334334Zinc finger protein ZIC 4
PRO_0000047253Add
BLAST

Proteomic databases

PaxDbiQ8N9L1.
PRIDEiQ8N9L1.

PTM databases

PhosphoSiteiQ8N9L1.

Expressioni

Gene expression databases

ArrayExpressiQ8N9L1.
BgeeiQ8N9L1.
CleanExiHS_ZIC4.
GenevestigatoriQ8N9L1.

Organism-specific databases

HPAiCAB022615.

Interactioni

Protein-protein interaction databases

IntActiQ8N9L1. 1 interaction.
STRINGi9606.ENSP00000372553.

Structurei

3D structure databases

ProteinModelPortaliQ8N9L1.
SMRiQ8N9L1. Positions 122-289.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi23 – 275Poly-Ser
Compositional biasi88 – 947Poly-Ala

Sequence similaritiesi

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
HOGENOMiHOG000232057.
HOVERGENiHBG007135.
InParanoidiQ8N9L1.
KOiK09225.
OMAiPSSDCGH.
OrthoDBiEOG76472R.
PhylomeDBiQ8N9L1.
TreeFamiTF351425.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8N9L1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRYKTSLVMR KRLRLYRNTL KESSSSSGHH GPQLTAASSP SVFPGLHEEP    50
PQASPSRPLN GLLRLGLPGD MYARPEPFPP GPAARSDALA AAAALHGYGG 100
MNLTVNLAAP HGPGAFFRYM RQPIKQELIC KWLAADGTAT PSLCSKTFST 150
MHELVTHVTV EHVGGPEQAN HICFWEECPR QGKPFKAKYK LVNHIRVHTG 200
EKPFPCPFPG CGKVFARSEN LKIHKRTHTG EKPFRCEFEG CERRFANSSD 250
RKKHSHVHTS DKPYTCKVRG CDKCYTHPSS LRKHMKVHGR SPPPSSGYDS 300
ATPSALVSPS SDCGHKSQVA SSAAVAARTA DLSE 334
Length:334
Mass (Da):36,567
Last modified:January 24, 2006 - v3
Checksum:i9EFEA2447D7B2F64
GO
Isoform 2 (identifier: Q8N9L1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     231-256: EKPFRCEFEGCERRFANSSDRKKHSH → QYSALSVACGPSGEAGPRVWISSSPN
     257-334: Missing.

Note: May be due to an intron retention. No experimental confirmation available.

Show »
Length:256
Mass (Da):27,838
Checksum:iC75BDAAD918C8BFE
GO
Isoform 3 (identifier: Q8N9L1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPPFCRNAKLGLLSFLICAGRSLLPLGKNAFWLERIENNNTLWEKAQSQKM

Note: No experimental confirmation available.

Show »
Length:384
Mass (Da):42,267
Checksum:i40BD96F45E1B4F47
GO
Isoform 4 (identifier: Q8N9L1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-230: Missing.

Note: No experimental confirmation available.

Show »
Length:128
Mass (Da):14,362
Checksum:iD149681B97FCA014
GO
Isoform 5 (identifier: Q8N9L1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MNGPCQSLRKAEGLLEGCTSAVTVFRKLPLDSKAQSQKM

Note: No experimental confirmation available.

Show »
Length:372
Mass (Da):40,641
Checksum:iB63E4DACB096BE02
GO

Sequence cautioni

The sequence AAH29507.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence starting in position 229.
The sequence AAK06845.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MPPFCRNAKLGLLSFLICAG RSLLPLGKNAFWLERIENNN TLWEKAQSQKM in isoform 3.
VSP_044484
Alternative sequencei1 – 11M → MNGPCQSLRKAEGLLEGCTS AVTVFRKLPLDSKAQSQKM in isoform 5.
VSP_046072
Alternative sequencei25 – 230206Missing in isoform 4.
VSP_045529Add
BLAST
Alternative sequencei231 – 25626EKPFR…KKHSH → QYSALSVACGPSGEAGPRVW ISSSPN in isoform 2.
VSP_017066Add
BLAST
Alternative sequencei257 – 33478Missing in isoform 2.
VSP_017067Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti100 – 1001G → V in BAG57350. 1 Publication
Sequence conflicti228 – 2281H → Q in AAH29507. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK056262 mRNA. Translation: BAG51660.1.
AK094286 mRNA. Translation: BAC04322.1.
AK293981 mRNA. Translation: BAG57350.1.
AK294831 mRNA. Translation: BAH11898.1.
DA218617 mRNA. No translation available.
AC092959 Genomic DNA. No translation available.
BC029507 mRNA. Translation: AAH29507.1. Sequence problems.
BC126267 mRNA. Translation: AAI26268.1.
BC136339 mRNA. Translation: AAI36340.1.
AF332509 mRNA. Translation: AAK06845.1. Different initiation.
CCDSiCCDS43160.1. [Q8N9L1-1]
CCDS54652.1. [Q8N9L1-3]
CCDS54653.1. [Q8N9L1-5]
CCDS58857.1. [Q8N9L1-4]
RefSeqiNP_001161850.1. NM_001168378.1. [Q8N9L1-3]
NP_001161851.1. NM_001168379.1. [Q8N9L1-5]
NP_001230185.1. NM_001243256.1. [Q8N9L1-4]
NP_115529.2. NM_032153.5. [Q8N9L1-1]
UniGeneiHs.415766.
Hs.739084.

Genome annotation databases

EnsembliENST00000383075; ENSP00000372553; ENSG00000174963. [Q8N9L1-1]
ENST00000425731; ENSP00000397695; ENSG00000174963. [Q8N9L1-5]
ENST00000473123; ENSP00000420775; ENSG00000174963. [Q8N9L1-1]
ENST00000484399; ENSP00000417855; ENSG00000174963. [Q8N9L1-1]
ENST00000491672; ENSP00000418277; ENSG00000174963. [Q8N9L1-4]
ENST00000525172; ENSP00000435509; ENSG00000174963. [Q8N9L1-3]
GeneIDi84107.
KEGGihsa:84107.
UCSCiuc003ewc.2. human. [Q8N9L1-1]
uc011bno.2. human. [Q8N9L1-3]

Polymorphism databases

DMDMi85700440.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK056262 mRNA. Translation: BAG51660.1 .
AK094286 mRNA. Translation: BAC04322.1 .
AK293981 mRNA. Translation: BAG57350.1 .
AK294831 mRNA. Translation: BAH11898.1 .
DA218617 mRNA. No translation available.
AC092959 Genomic DNA. No translation available.
BC029507 mRNA. Translation: AAH29507.1 . Sequence problems.
BC126267 mRNA. Translation: AAI26268.1 .
BC136339 mRNA. Translation: AAI36340.1 .
AF332509 mRNA. Translation: AAK06845.1 . Different initiation.
CCDSi CCDS43160.1. [Q8N9L1-1 ]
CCDS54652.1. [Q8N9L1-3 ]
CCDS54653.1. [Q8N9L1-5 ]
CCDS58857.1. [Q8N9L1-4 ]
RefSeqi NP_001161850.1. NM_001168378.1. [Q8N9L1-3 ]
NP_001161851.1. NM_001168379.1. [Q8N9L1-5 ]
NP_001230185.1. NM_001243256.1. [Q8N9L1-4 ]
NP_115529.2. NM_032153.5. [Q8N9L1-1 ]
UniGenei Hs.415766.
Hs.739084.

3D structure databases

ProteinModelPortali Q8N9L1.
SMRi Q8N9L1. Positions 122-289.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q8N9L1. 1 interaction.
STRINGi 9606.ENSP00000372553.

PTM databases

PhosphoSitei Q8N9L1.

Polymorphism databases

DMDMi 85700440.

Proteomic databases

PaxDbi Q8N9L1.
PRIDEi Q8N9L1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000383075 ; ENSP00000372553 ; ENSG00000174963 . [Q8N9L1-1 ]
ENST00000425731 ; ENSP00000397695 ; ENSG00000174963 . [Q8N9L1-5 ]
ENST00000473123 ; ENSP00000420775 ; ENSG00000174963 . [Q8N9L1-1 ]
ENST00000484399 ; ENSP00000417855 ; ENSG00000174963 . [Q8N9L1-1 ]
ENST00000491672 ; ENSP00000418277 ; ENSG00000174963 . [Q8N9L1-4 ]
ENST00000525172 ; ENSP00000435509 ; ENSG00000174963 . [Q8N9L1-3 ]
GeneIDi 84107.
KEGGi hsa:84107.
UCSCi uc003ewc.2. human. [Q8N9L1-1 ]
uc011bno.2. human. [Q8N9L1-3 ]

Organism-specific databases

CTDi 84107.
GeneCardsi GC03M147103.
HGNCi HGNC:20393. ZIC4.
HPAi CAB022615.
MIMi 608948. gene.
neXtProti NX_Q8N9L1.
Orphaneti 269212. Isolated Dandy-Walker malformation with hydrocephalus.
269215. Isolated Dandy-Walker malformation without hydrocephalus.
PharmGKBi PA134937175.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
HOGENOMi HOG000232057.
HOVERGENi HBG007135.
InParanoidi Q8N9L1.
KOi K09225.
OMAi PSSDCGH.
OrthoDBi EOG76472R.
PhylomeDBi Q8N9L1.
TreeFami TF351425.

Miscellaneous databases

GenomeRNAii 84107.
NextBioi 35535333.
PROi Q8N9L1.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q8N9L1.
Bgeei Q8N9L1.
CleanExi HS_ZIC4.
Genevestigatori Q8N9L1.

Family and domain databases

Gene3Di 3.30.160.60. 4 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF00096. zf-C2H2. 1 hit.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 5 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 3 hits.
PS50157. ZINC_FINGER_C2H2_2. 4 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5).
    Tissue: Brain and Cerebellum.
  2. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. Warder D.E.
    Submitted (DEC-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 25-334 (ISOFORM 2).
    Tissue: Medulloblastoma.

Entry informationi

Entry nameiZIC4_HUMAN
AccessioniPrimary (citable) accession number: Q8N9L1
Secondary accession number(s): A0AVA2
, B2RMQ8, B4DF89, B7Z2L2, C9J7D5, J3KQG1, Q4G157, Q9BZ94
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 22, 2003
Last sequence update: January 24, 2006
Last modified: July 9, 2014
This is version 107 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi