Reviewed,
UniProtKB/Swiss-Prot Q8N9H6 (CH031_HUMAN)
Last modified
November 24, 2009.
Version 38.
History...
Clusters with 100%,
90%,
50% identity |
 Documents (3) |
 Third-party data |
 Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Uncharacterized protein C8orf31 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 132 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at transcript level. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N9H6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N9H6-2) The sequence of this isoform differs from the canonical sequence as follows: 30-34: Missing. 66-132: SALAPQGLTAKDAHFLGDTDPIQEGARDHAAGGPFQDRQASVAAQTLSWERGQGFSRHHGNHLLYSH → GR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 132 | 132 | Uncharacterized protein C8orf31 | PRO_0000294238 | |||||
Natural variations | |||||||||
| Alternative sequence | 30 – 34 | 5 | Missing in isoform 2. | VSP_026610 | |||||
| Alternative sequence | 66 – 132 | 67 | SALAP…LLYSH → GR in isoform 2. | VSP_026611 | |||||
| Natural variant | 39 | 1 | L → P: dbSNP rs11136300. | VAR_033150 | |||||
Experimental info | |||||||||
| Sequence conflict | 63 | 1 | N → V in AAH73830. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.  Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cerebellum. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Placenta. |
Cross-references
Sequence databases | |
|---|---|
| AK094450 mRNA. Translation: BAC04358.1. BC073830 mRNA. Translation: AAH73830.1. | |
| IPI | IPI00167724. IPI00853200. |
| RefSeq | NP_775958.1. |
| UniGene | Hs.660382 |
3D structure databases | |
| ModBase | Search... |
Proteomic databases | |
| PRIDE | Q8N9H6. |
Genome annotation databases | |
| Ensembl | ENST00000316682; ENSP00000314418; ENSG00000177335; Homo sapiens. [Genome view] ENST00000395172; ENSP00000378601; ENSG00000177335; Homo sapiens. [Genome view] |
| GeneID | 286122. |
| KEGG | hsa:286122. |
| UCSC | uc003yxp.1. human. |
Organism-specific databases | |
| CTD | 286122. |
| GeneCards | GC08P144193. |
| HGNC | HGNC:26731. C8orf31. |
| PharmGKB | PA142672350. |
| GenAtlas | Search... |
Phylogenomic databases | |
| OMA | EIWESTT |
| OrthoDB | EOG915K17 |
Gene expression databases | |
| ArrayExpress | Q8N9H6. |
| Bgee | Q8N9H6. |
| CleanEx | HS_C8orf31. |
| Genevestigator | Q8N9H6. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 95995. |
Entry information
| Entry name | CH031_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N9H6 Secondary accession number(s): Q6GMU7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
