Q8N9H6 (CH031_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 49.
History...
Names·Attributes·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uncharacterized protein C8orf31 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 132 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N9H6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N9H6-2) The sequence of this isoform differs from the canonical sequence as follows: 30-34: Missing. 66-132: SALAPQGLTAKDAHFLGDTDPIQEGARDHAAGGPFQDRQASVAAQTLSWERGQGFSRHHGNHLLYSH → GR | ||||||
| Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 132 | 132 | Uncharacterized protein C8orf31 | PRO_0000294238 | |||||
Natural variations | |||||||||
| Alternative sequence | 30 – 34 | 5 | Missing in isoform 2. | VSP_026610 | |||||
| Alternative sequence | 66 – 132 | 67 | SALAP…LLYSH → GR in isoform 2. | VSP_026611 | |||||
| Natural variant | 39 | 1 | L → P. Corresponds to variant rs11136300 [ dbSNP | Ensembl ]. | VAR_033150 | |||||
Experimental info | |||||||||
| Sequence conflict | 63 | 1 | N → V in AAH73830. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Cerebellum. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Placenta. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK094450 mRNA. Translation: BAC04358.1. BC073830 mRNA. Translation: AAH73830.1. |
| IPI | IPI00167724. IPI00853200. |
| RefSeq | NP_775958.1. NM_173687.2. |
| UniGene | Hs.660382. |
3D structure databases | |
| ProteinModelPortal | Q8N9H6. |
| ModBase | Search... |
Polymorphism databases | |
| DMDM | 74729689. |
Proteomic databases | |
| PRIDE | Q8N9H6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000316682; ENSP00000314418; ENSG00000177335. ENST00000395172; ENSP00000378601; ENSG00000177335. |
| GeneID | 286122. |
| KEGG | hsa:286122. |
| UCSC | uc003yxp.1. human. |
Organism-specific databases | |
| CTD | 286122. |
| GeneCards | GC08P144193. |
| HGNC | HGNC:26731. C8orf31. |
| neXtProt | NX_Q8N9H6. |
| PharmGKB | PA142672350. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000011693. |
| InParanoid | Q8N9H6. |
| OMA | GSCTHRA. |
| OrthoDB | EOG4HT8TK. |
Gene expression databases | |
| ArrayExpress | Q8N9H6. |
| Bgee | Q8N9H6. |
| CleanEx | HS_C8orf31. |
| Genevestigator | Q8N9H6. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 95995. |
Entry information
| Entry name | CH031_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N9H6 Secondary accession number(s): Q6GMU7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with