Q8N960 (CE120_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Centrosomal protein of 120 kDa Short name=Cep120 Alternative name(s): Coiled-coil domain-containing protein 100 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 986 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Plays a role in the microtubule-dependent coupling of the nucleus and the centrosome. Involved in the processes that regulate centrosome-mediated interkinetic nuclear migration (INM) of neural progenitors and for proper positioning of neurons during brain development. Also implicated in the migration and selfrenewal of neural progenitors. May play a role in centriole duplication during mitosis By similarity. |
| Subunit structure | Interacts with TACC2 and TACC3 By similarity. Interacts with CCDC52 By similarity. |
| Subcellular location | Cytoplasm › cytoskeleton › centrosome By similarity. Note: Regulates the localization of TACC3 to the centrosome in neural progenitors in vivo By similarity. |
| Sequence similarities | Belongs to the CEP120 family. |
| Sequence caution | The sequence BAC04155.1 differs from that shown. Reason: Erroneous initiation. The sequence CAH10561.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | astral microtubule organization Inferred from electronic annotation. Source: Compara cerebral cortex developmentInferred from electronic annotation. Source: Compara interkinetic nuclear migrationInferred from electronic annotation. Source: Compara neurogenesisInferred from electronic annotation. Source: Compara regulation of microtubule-based processInferred from electronic annotation. Source: Compara regulation of protein localizationInferred from electronic annotation. Source: Compara |
| Cellular_component | centrosome Inferred from direct assay PubMed 21399614. Source: UniProtKB cytoplasmInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N960-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N960-2) The sequence of this isoform differs from the canonical sequence as follows: 1-26: Missing. | ||||||
| Isoform 3 (identifier: Q8N960-3) The sequence of this isoform differs from the canonical sequence as follows: 347-380: SLIELKTQNEHEPEHSKKKVLTPIKEKTLTGPKS → DAFWYSALDIIFPLFIFLFLVLDAIRKFANYEEK 381-986: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 986 | 986 | Centrosomal protein of 120 kDa | PRO_0000348262 | |||||
Regions | |||||||||
| Coiled coil | 669 – 925 | 257 | Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 26 | 26 | Missing in isoform 2. | VSP_035123 | |||||
| Alternative sequence | 347 – 380 | 34 | SLIEL…TGPKS → DAFWYSALDIIFPLFIFLFL VLDAIRKFANYEEK in isoform 3. | VSP_035124 | |||||
| Alternative sequence | 381 – 986 | 606 | Missing in isoform 3. | VSP_035125 | |||||
| Natural variant | 602 | 1 | L → V. Ref.3 Corresponds to variant rs6595440 [ dbSNP | Ensembl ]. | VAR_046126 | |||||
| Natural variant | 879 | 1 | Q → H. Corresponds to variant rs1047437 [ dbSNP | Ensembl ]. | VAR_046127 | |||||
| Natural variant | 936 | 1 | V → I. Corresponds to variant rs2303721 [ dbSNP | Ensembl ]. | VAR_046128 | |||||
| Natural variant | 947 | 1 | R → H. Corresponds to variant rs2303720 [ dbSNP | Ensembl ]. | VAR_046129 | |||||
Experimental info | |||||||||
| Sequence conflict | 212 | 1 | L → F in BAC04596. Ref.3 | ||||||
| Sequence conflict | 246 | 1 | E → G in BAC04596. Ref.3 | ||||||
| Sequence conflict | 301 | 1 | H → R in CAH10371. Ref.4 | ||||||
| Sequence conflict | 785 | 1 | Q → L in BAC04596. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC010369 Genomic DNA. No translation available. AC106792 Genomic DNA. No translation available. BC040527 mRNA. No translation available. AK093409 mRNA. Translation: BAC04155.1. Different initiation. AK095646 mRNA. Translation: BAC04596.1. AL833929 mRNA. Translation: CAD38785.2. BX648687 mRNA. Translation: CAH10561.1. Different initiation. CR627324 mRNA. Translation: CAH10371.1. |
| IPI | IPI00171224. IPI00217258. IPI00748877. |
| RefSeq | NP_001159698.1. NM_001166226.1. NP_694955.2. NM_153223.3. |
| UniGene | Hs.483209. |
3D structure databases | |
| ProteinModelPortal | Q8N960. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q8N960. 2 interactions. |
| MINT | MINT-7034560. |
| STRING | 9606.ENSP00000303058. |
Polymorphism databases | |
| DMDM | 205696377. |
Proteomic databases | |
| PaxDb | Q8N960. |
| PRIDE | Q8N960. |
Protocols and materials databases | |
| DNASU | 153241. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000306467; ENSP00000303058; ENSG00000168944. ENST00000306481; ENSP00000307419; ENSG00000168944. ENST00000328236; ENSP00000327504; ENSG00000168944. ENST00000395431; ENSP00000378819; ENSG00000168944. ENST00000513565; ENSP00000422089; ENSG00000168944. |
| GeneID | 153241. |
| KEGG | hsa:153241. |
| UCSC | uc003ktk.3. human. |
Organism-specific databases | |
| CTD | 153241. |
| GeneCards | GC05M122708. |
| HGNC | HGNC:26690. CEP120. |
| HPA | HPA028823. |
| MIM | 613446. gene. |
| neXtProt | NX_Q8N960. |
| PharmGKB | PA164717857. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG140545. |
| HOGENOM | HOG000007674. |
| HOVERGEN | HBG107643. |
| InParanoid | Q8N960. |
| KO | K16459. |
| OMA | SLQYDKD. |
| OrthoDB | EOG4KD6KK. |
Gene expression databases | |
| ArrayExpress | Q8N960. |
| Bgee | Q8N960. |
| CleanEx | HS_CEP120. |
| Genevestigator | Q8N960. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR022136. DUF3668. [Graphical view] |
| Pfam | PF12416. DUF3668. 1 hit. [Graphical view] |
| SMART | SM00239. C2. 1 hit. [Graphical view] |
| SUPFAM | SSF49562. C2_CaLB. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 153241. |
| NextBio | 87092. |
| SOURCE | Search... |
Entry information
| Entry name | CE120_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N960 Secondary accession number(s): Q6AI52 Q8NDE8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
