Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8N8Q1 (C56D1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 93. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Cytochrome b561 domain-containing protein 1
Gene names
Name:CYB561D1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length229 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Cofactor

Binds 2 heme groups non-covalently By similarity.

Subcellular location

Membrane; Multi-pass membrane protein Probable.

Sequence similarities

Contains 1 cytochrome b561 domain.

Ontologies

Keywords
   Biological processElectron transport
Transport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   LigandHeme
Iron
Metal-binding
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processoxidation-reduction process

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

   Molecular_functionmetal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8N8Q1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8N8Q1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     50-133: SLFSWHPVFM...VSWHSWVGAL → KTGPLMEDRS...GSGSTGQGRP
     134-229: Missing.
Isoform 3 (identifier: Q8N8Q1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     50-62: SLFSWHPVFMALA → KTGPLMEDRSEGGRARWVMPEIPALWEADAGGSLE
Isoform 4 (identifier: Q8N8Q1-4)

The sequence of this isoform differs from the canonical sequence as follows:
     50-229: SLFSWHPVFM...SYLPRKKMEM → KTGPLMEDRS...PMFTVLPLHG
Note: Gene prediction based on EST data.
Isoform 5 (identifier: Q8N8Q1-5)

The sequence of this isoform differs from the canonical sequence as follows:
     6-62: Missing.
Note: Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 229229Cytochrome b561 domain-containing protein 1
PRO_0000151034

Regions

Topological domain1 – 2424Cytoplasmic Potential
Transmembrane25 – 4521Helical; Potential
Transmembrane54 – 7421Helical; Potential
Transmembrane92 – 11221Helical; Potential
Transmembrane129 – 14921Helical; Potential
Transmembrane170 – 19021Helical; Potential
Transmembrane194 – 21421Helical; Potential
Topological domain215 – 22915Cytoplasmic Potential
Domain22 – 224203Cytochrome b561

Sites

Metal binding551Iron (heme axial ligand) Potential
Metal binding931Iron (heme axial ligand) Potential
Metal binding1271Iron (heme axial ligand) Potential
Metal binding1661Iron (heme axial ligand) Potential

Natural variations

Alternative sequence6 – 6257Missing in isoform 5.
VSP_046985
Alternative sequence50 – 229180SLFSW…KKMEM → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLEVFSPG TLYSWPWRMYESTSFFSGLQ ARHEAYWLSPMFTVLPLHG in isoform 4.
VSP_046986
Alternative sequence50 – 13384SLFSW…WVGAL → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLEVFSPG TLYSWPWRSASAWLKPSYSS HLNTPCSSSAPEKHGSGSTG QGRP in isoform 2.
VSP_038649
Alternative sequence50 – 6213SLFSW…FMALA → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLE in isoform 3.
VSP_041162
Alternative sequence134 – 22996Missing in isoform 2.
VSP_038650

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2002. Version 1.
Checksum: 43978DAF7D8EC218

FASTA22925,424
        10         20         30         40         50         60 
MQPLEVGLVP APAGEPRLTR WLRRGSGILA HLVALGFTIF LTALSRPGTS LFSWHPVFMA 

        70         80         90        100        110        120 
LAFCLCMAEA ILLFSPEHSL FFFCSRKARI RLHWAGQTLA ILCAALGLGF IISSRTRSEL 

       130        140        150        160        170        180 
PHLVSWHSWV GALTLLATAV QALCGLCLLC PRAARVSRVA RLKLYHLTCG LVVYLMATVT 

       190        200        210        220 
VLLGMYSVWF QAQIKGAAWY LCLALPVYPA LVIMHQISRS YLPRKKMEM 

« Hide

Isoform 2 [UniParc].

Checksum: 60B7E9CE48574852
Show »

FASTA13314,251
Isoform 3 [UniParc].

Checksum: 9F8B854A243A1492
Show »

FASTA25127,731
Isoform 4 [UniParc].

Checksum: BE94AF3C98A3AB6A
Show »

FASTA12814,197
Isoform 5 [UniParc].

Checksum: 2665E7E094E494F1
Show »

FASTA17219,314

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
Tissue: Brain.
[2]"Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes."
Kimura K., Wakamatsu A., Suzuki Y., Ota T., Nishikawa T., Yamashita R., Yamamoto J., Sekine M., Tsuritani K., Wakaguri H., Ishii S., Sugiyama T., Saito K., Isono Y., Irie R., Kushida N., Yoneyama T., Otsuka R. expand/collapse author list , Kanda K., Yokoi T., Kondo H., Wagatsuma M., Murakawa K., Ishida S., Ishibashi T., Takahashi-Fujii A., Tanase T., Nagai K., Kikuchi H., Nakai K., Isogai T., Sugano S.
Genome Res. 16:55-65(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Liver.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK096354 mRNA. Translation: BAC04767.1.
AK294992 mRNA. Translation: BAG58058.1.
DA092655 mRNA. No translation available.
AL355145 Genomic DNA. Translation: CAI22940.1.
AL355145 Genomic DNA. Translation: CAI22941.1.
BC093683 mRNA. Translation: AAH93683.1.
BC111999 mRNA. Translation: AAI12000.1.
CCDSCCDS44188.1. [Q8N8Q1-3]
CCDS44189.1. [Q8N8Q1-5]
CCDS44190.1. [Q8N8Q1-2]
CCDS44191.1. [Q8N8Q1-4]
CCDS800.1. [Q8N8Q1-1]
RefSeqNP_001127872.1. NM_001134400.1. [Q8N8Q1-3]
NP_001127874.1. NM_001134402.1. [Q8N8Q1-5]
NP_872386.1. NM_182580.2. [Q8N8Q1-1]
UniGeneHs.514682.

3D structure databases

ProteinModelPortalQ8N8Q1.
SMRQ8N8Q1. Positions 17-195.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000358884.

PTM databases

PhosphoSiteQ8N8Q1.

Polymorphism databases

DMDM67462193.

Proteomic databases

MaxQBQ8N8Q1.
PRIDEQ8N8Q1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000310611; ENSP00000309324; ENSG00000174151. [Q8N8Q1-2]
ENST00000369868; ENSP00000358884; ENSG00000174151. [Q8N8Q1-3]
ENST00000393709; ENSP00000377312; ENSG00000174151. [Q8N8Q1-5]
ENST00000420578; ENSP00000413530; ENSG00000174151. [Q8N8Q1-1]
ENST00000430195; ENSP00000416898; ENSG00000174151. [Q8N8Q1-4]
GeneID284613.
KEGGhsa:284613.
UCSCuc001dxu.3. human. [Q8N8Q1-2]
uc010ovm.2. human. [Q8N8Q1-1]
uc010ovo.2. human. [Q8N8Q1-3]

Organism-specific databases

CTD284613.
GeneCardsGC01P110036.
HGNCHGNC:26804. CYB561D1.
HPAHPA027028.
neXtProtNX_Q8N8Q1.
PharmGKBPA134872038.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG74881.
HOGENOMHOG000008685.
HOVERGENHBG050754.
InParanoidQ8N8Q1.
OMAFSWHPVF.
OrthoDBEOG7R2BKS.
PhylomeDBQ8N8Q1.
TreeFamTF323584.

Gene expression databases

ArrayExpressQ8N8Q1.
BgeeQ8N8Q1.
CleanExHS_CYB561D1.
GenevestigatorQ8N8Q1.

Family and domain databases

InterProIPR006593. Cyt_b561/ferric_Rdtase_TM.
IPR004877. Cyt_b561_euk.
[Graphical view]
PfamPF03188. Cytochrom_B561. 1 hit.
[Graphical view]
SMARTSM00665. B561. 1 hit.
[Graphical view]
PROSITEPS50939. CYTOCHROME_B561. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi284613.
NextBio95003.
PROQ8N8Q1.

Entry information

Entry nameC56D1_HUMAN
AccessionPrimary (citable) accession number: Q8N8Q1
Secondary accession number(s): B4DH97 expand/collapse secondary AC list , E9PCM8, Q52M36, Q5T6C2, Q5T6C3
Entry history
Integrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: October 1, 2002
Last modified: July 9, 2014
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM