Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8N8Q1

- C56D1_HUMAN

UniProt

Q8N8Q1 - C56D1_HUMAN

Protein

Cytochrome b561 domain-containing protein 1

Gene

CYB561D1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 94 (01 Oct 2014)
      Sequence version 1 (01 Oct 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Cofactori

    Binds 2 heme groups non-covalently.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi55 – 551Iron (heme axial ligand)PROSITE-ProRule annotation
    Metal bindingi93 – 931Iron (heme axial ligand)PROSITE-ProRule annotation
    Metal bindingi127 – 1271Iron (heme axial ligand)PROSITE-ProRule annotation
    Metal bindingi166 – 1661Iron (heme axial ligand)PROSITE-ProRule annotation

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW

    GO - Biological processi

    1. oxidation-reduction process Source: UniProtKB-KW

    Keywords - Biological processi

    Electron transport, Transport

    Keywords - Ligandi

    Heme, Iron, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cytochrome b561 domain-containing protein 1
    Gene namesi
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:26804. CYB561D1.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134872038.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 229229Cytochrome b561 domain-containing protein 1PRO_0000151034Add
    BLAST

    Proteomic databases

    MaxQBiQ8N8Q1.
    PRIDEiQ8N8Q1.

    PTM databases

    PhosphoSiteiQ8N8Q1.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8N8Q1.
    BgeeiQ8N8Q1.
    CleanExiHS_CYB561D1.
    GenevestigatoriQ8N8Q1.

    Organism-specific databases

    HPAiHPA027028.

    Interactioni

    Protein-protein interaction databases

    STRINGi9606.ENSP00000358884.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8N8Q1.
    SMRiQ8N8Q1. Positions 17-195.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 2424CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini215 – 22915CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei25 – 4521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei54 – 7421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei92 – 11221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei129 – 14921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei170 – 19021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei194 – 21421HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini22 – 224203Cytochrome b561PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 cytochrome b561 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG74881.
    HOGENOMiHOG000008685.
    HOVERGENiHBG050754.
    InParanoidiQ8N8Q1.
    OMAiFSWHPVF.
    OrthoDBiEOG7R2BKS.
    PhylomeDBiQ8N8Q1.
    TreeFamiTF323584.

    Family and domain databases

    InterProiIPR006593. Cyt_b561/ferric_Rdtase_TM.
    IPR004877. Cyt_b561_euk.
    [Graphical view]
    PfamiPF03188. Cytochrom_B561. 1 hit.
    [Graphical view]
    SMARTiSM00665. B561. 1 hit.
    [Graphical view]
    PROSITEiPS50939. CYTOCHROME_B561. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8N8Q1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MQPLEVGLVP APAGEPRLTR WLRRGSGILA HLVALGFTIF LTALSRPGTS    50
    LFSWHPVFMA LAFCLCMAEA ILLFSPEHSL FFFCSRKARI RLHWAGQTLA 100
    ILCAALGLGF IISSRTRSEL PHLVSWHSWV GALTLLATAV QALCGLCLLC 150
    PRAARVSRVA RLKLYHLTCG LVVYLMATVT VLLGMYSVWF QAQIKGAAWY 200
    LCLALPVYPA LVIMHQISRS YLPRKKMEM 229
    Length:229
    Mass (Da):25,424
    Last modified:October 1, 2002 - v1
    Checksum:i43978DAF7D8EC218
    GO
    Isoform 2 (identifier: Q8N8Q1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         50-133: SLFSWHPVFM...VSWHSWVGAL → KTGPLMEDRS...GSGSTGQGRP
         134-229: Missing.

    Show »
    Length:133
    Mass (Da):14,251
    Checksum:i60B7E9CE48574852
    GO
    Isoform 3 (identifier: Q8N8Q1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         50-62: SLFSWHPVFMALA → KTGPLMEDRSEGGRARWVMPEIPALWEADAGGSLE

    Show »
    Length:251
    Mass (Da):27,731
    Checksum:i9F8B854A243A1492
    GO
    Isoform 4 (identifier: Q8N8Q1-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         50-229: SLFSWHPVFM...SYLPRKKMEM → KTGPLMEDRS...PMFTVLPLHG

    Note: Gene prediction based on EST data.

    Show »
    Length:128
    Mass (Da):14,197
    Checksum:iBE94AF3C98A3AB6A
    GO
    Isoform 5 (identifier: Q8N8Q1-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         6-62: Missing.

    Note: Gene prediction based on EST data.

    Show »
    Length:172
    Mass (Da):19,314
    Checksum:i2665E7E094E494F1
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei6 – 6257Missing in isoform 5. CuratedVSP_046985Add
    BLAST
    Alternative sequencei50 – 229180SLFSW…KKMEM → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLEVFSPG TLYSWPWRMYESTSFFSGLQ ARHEAYWLSPMFTVLPLHG in isoform 4. CuratedVSP_046986Add
    BLAST
    Alternative sequencei50 – 13384SLFSW…WVGAL → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLEVFSPG TLYSWPWRSASAWLKPSYSS HLNTPCSSSAPEKHGSGSTG QGRP in isoform 2. 1 PublicationVSP_038649Add
    BLAST
    Alternative sequencei50 – 6213SLFSW…FMALA → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLE in isoform 3. 1 PublicationVSP_041162Add
    BLAST
    Alternative sequencei134 – 22996Missing in isoform 2. 1 PublicationVSP_038650Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK096354 mRNA. Translation: BAC04767.1.
    AK294992 mRNA. Translation: BAG58058.1.
    DA092655 mRNA. No translation available.
    AL355145 Genomic DNA. Translation: CAI22940.1.
    AL355145 Genomic DNA. Translation: CAI22941.1.
    BC093683 mRNA. Translation: AAH93683.1.
    BC111999 mRNA. Translation: AAI12000.1.
    CCDSiCCDS44188.1. [Q8N8Q1-3]
    CCDS44189.1. [Q8N8Q1-5]
    CCDS44190.1. [Q8N8Q1-2]
    CCDS44191.1. [Q8N8Q1-4]
    CCDS800.1. [Q8N8Q1-1]
    RefSeqiNP_001127872.1. NM_001134400.1. [Q8N8Q1-3]
    NP_001127874.1. NM_001134402.1. [Q8N8Q1-5]
    NP_872386.1. NM_182580.2. [Q8N8Q1-1]
    UniGeneiHs.514682.

    Genome annotation databases

    EnsembliENST00000310611; ENSP00000309324; ENSG00000174151. [Q8N8Q1-2]
    ENST00000369868; ENSP00000358884; ENSG00000174151. [Q8N8Q1-3]
    ENST00000393709; ENSP00000377312; ENSG00000174151. [Q8N8Q1-5]
    ENST00000420578; ENSP00000413530; ENSG00000174151. [Q8N8Q1-1]
    ENST00000430195; ENSP00000416898; ENSG00000174151. [Q8N8Q1-4]
    GeneIDi284613.
    KEGGihsa:284613.
    UCSCiuc001dxu.3. human. [Q8N8Q1-2]
    uc010ovm.2. human. [Q8N8Q1-1]
    uc010ovo.2. human. [Q8N8Q1-3]

    Polymorphism databases

    DMDMi67462193.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK096354 mRNA. Translation: BAC04767.1 .
    AK294992 mRNA. Translation: BAG58058.1 .
    DA092655 mRNA. No translation available.
    AL355145 Genomic DNA. Translation: CAI22940.1 .
    AL355145 Genomic DNA. Translation: CAI22941.1 .
    BC093683 mRNA. Translation: AAH93683.1 .
    BC111999 mRNA. Translation: AAI12000.1 .
    CCDSi CCDS44188.1. [Q8N8Q1-3 ]
    CCDS44189.1. [Q8N8Q1-5 ]
    CCDS44190.1. [Q8N8Q1-2 ]
    CCDS44191.1. [Q8N8Q1-4 ]
    CCDS800.1. [Q8N8Q1-1 ]
    RefSeqi NP_001127872.1. NM_001134400.1. [Q8N8Q1-3 ]
    NP_001127874.1. NM_001134402.1. [Q8N8Q1-5 ]
    NP_872386.1. NM_182580.2. [Q8N8Q1-1 ]
    UniGenei Hs.514682.

    3D structure databases

    ProteinModelPortali Q8N8Q1.
    SMRi Q8N8Q1. Positions 17-195.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000358884.

    PTM databases

    PhosphoSitei Q8N8Q1.

    Polymorphism databases

    DMDMi 67462193.

    Proteomic databases

    MaxQBi Q8N8Q1.
    PRIDEi Q8N8Q1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000310611 ; ENSP00000309324 ; ENSG00000174151 . [Q8N8Q1-2 ]
    ENST00000369868 ; ENSP00000358884 ; ENSG00000174151 . [Q8N8Q1-3 ]
    ENST00000393709 ; ENSP00000377312 ; ENSG00000174151 . [Q8N8Q1-5 ]
    ENST00000420578 ; ENSP00000413530 ; ENSG00000174151 . [Q8N8Q1-1 ]
    ENST00000430195 ; ENSP00000416898 ; ENSG00000174151 . [Q8N8Q1-4 ]
    GeneIDi 284613.
    KEGGi hsa:284613.
    UCSCi uc001dxu.3. human. [Q8N8Q1-2 ]
    uc010ovm.2. human. [Q8N8Q1-1 ]
    uc010ovo.2. human. [Q8N8Q1-3 ]

    Organism-specific databases

    CTDi 284613.
    GeneCardsi GC01P110036.
    HGNCi HGNC:26804. CYB561D1.
    HPAi HPA027028.
    neXtProti NX_Q8N8Q1.
    PharmGKBi PA134872038.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG74881.
    HOGENOMi HOG000008685.
    HOVERGENi HBG050754.
    InParanoidi Q8N8Q1.
    OMAi FSWHPVF.
    OrthoDBi EOG7R2BKS.
    PhylomeDBi Q8N8Q1.
    TreeFami TF323584.

    Miscellaneous databases

    GenomeRNAii 284613.
    NextBioi 95003.
    PROi Q8N8Q1.

    Gene expression databases

    ArrayExpressi Q8N8Q1.
    Bgeei Q8N8Q1.
    CleanExi HS_CYB561D1.
    Genevestigatori Q8N8Q1.

    Family and domain databases

    InterProi IPR006593. Cyt_b561/ferric_Rdtase_TM.
    IPR004877. Cyt_b561_euk.
    [Graphical view ]
    Pfami PF03188. Cytochrom_B561. 1 hit.
    [Graphical view ]
    SMARTi SM00665. B561. 1 hit.
    [Graphical view ]
    PROSITEi PS50939. CYTOCHROME_B561. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Liver.

    Entry informationi

    Entry nameiC56D1_HUMAN
    AccessioniPrimary (citable) accession number: Q8N8Q1
    Secondary accession number(s): B4DH97
    , E9PCM8, Q52M36, Q5T6C2, Q5T6C3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 10, 2005
    Last sequence update: October 1, 2002
    Last modified: October 1, 2014
    This is version 94 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3