Q8N8Q1 (C56D1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cytochrome b561 domain-containing protein 1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 229 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Cofactor | Binds 2 heme groups non-covalently By similarity. |
| Subcellular location | Membrane; Multi-pass membrane protein Probable. |
| Sequence similarities | Contains 1 cytochrome b561 domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Electron transport Transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Heme Iron Metal-binding |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | electron transport chain Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N8Q1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N8Q1-2) The sequence of this isoform differs from the canonical sequence as follows: 50-133: SLFSWHPVFM...VSWHSWVGAL → KTGPLMEDRS...GSGSTGQGRP 134-229: Missing. | ||||||
| Isoform 3 (identifier: Q8N8Q1-3) The sequence of this isoform differs from the canonical sequence as follows: 50-62: SLFSWHPVFMALA → KTGPLMEDRSEGGRARWVMPEIPALWEADAGGSLE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 229 | 229 | Cytochrome b561 domain-containing protein 1 | PRO_0000151034 | |||||
Regions | |||||||||
| Topological domain | 1 – 24 | 24 | Cytoplasmic Potential | ||||||
| Transmembrane | 25 – 45 | 21 | Helical; Potential | ||||||
| Transmembrane | 54 – 74 | 21 | Helical; Potential | ||||||
| Transmembrane | 92 – 112 | 21 | Helical; Potential | ||||||
| Transmembrane | 129 – 149 | 21 | Helical; Potential | ||||||
| Transmembrane | 170 – 190 | 21 | Helical; Potential | ||||||
| Transmembrane | 194 – 214 | 21 | Helical; Potential | ||||||
| Topological domain | 215 – 229 | 15 | Cytoplasmic Potential | ||||||
| Domain | 22 – 224 | 203 | Cytochrome b561 | ||||||
Sites | |||||||||
| Metal binding | 55 | 1 | Iron (heme axial ligand) Potential | ||||||
| Metal binding | 93 | 1 | Iron (heme axial ligand) Potential | ||||||
| Metal binding | 127 | 1 | Iron (heme axial ligand) Potential | ||||||
| Metal binding | 166 | 1 | Iron (heme axial ligand) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 50 – 133 | 84 | SLFSW…WVGAL → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLEVFSPG TLYSWPWRSASAWLKPSYSS HLNTPCSSSAPEKHGSGSTG QGRP in isoform 2. | VSP_038649 | |||||
| Alternative sequence | 50 – 62 | 13 | SLFSW…FMALA → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLE in isoform 3. | VSP_041162 | |||||
| Alternative sequence | 134 – 229 | 96 | Missing in isoform 2. | VSP_038650 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK096354 mRNA. Translation: BAC04767.1. AK294992 mRNA. Translation: BAG58058.1. DA092655 mRNA. No translation available. AL355145 Genomic DNA. Translation: CAI22940.1. AL355145 Genomic DNA. Translation: CAI22941.1. BC093683 mRNA. Translation: AAH93683.1. BC111999 mRNA. Translation: AAI12000.1. |
| IPI | IPI00167530. IPI00515012. IPI00909405. |
| RefSeq | NP_001127872.1. NM_001134400.1. NP_001127875.1. NM_001134403.1. NP_872386.1. NM_182580.2. |
| UniGene | Hs.514682. |
3D structure databases | |
| ProteinModelPortal | Q8N8Q1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000358884. |
PTM databases | |
| PhosphoSite | Q8N8Q1. |
Polymorphism databases | |
| DMDM | 67462193. |
Proteomic databases | |
| PRIDE | Q8N8Q1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000310611; ENSP00000309324; ENSG00000174151. ENST00000369868; ENSP00000358884; ENSG00000174151. ENST00000420578; ENSP00000413530; ENSG00000174151. |
| GeneID | 284613. |
| KEGG | hsa:284613. |
| UCSC | uc001dxu.3. human. uc010ovm.2. human. uc010ovo.2. human. |
Organism-specific databases | |
| CTD | 284613. |
| GeneCards | GC01P110036. |
| HGNC | HGNC:26804. CYB561D1. |
| HPA | HPA027028. |
| neXtProt | NX_Q8N8Q1. |
| PharmGKB | PA134872038. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG74881. |
| HOGENOM | HOG000008685. |
| HOVERGEN | HBG050754. |
| InParanoid | Q8N8Q1. |
| OMA | YSVWFQA. |
| PhylomeDB | Q8N8Q1. |
Gene expression databases | |
| ArrayExpress | Q8N8Q1. |
| Bgee | Q8N8Q1. |
| CleanEx | HS_CYB561D1. |
| Genevestigator | Q8N8Q1. |
| GermOnline | ENSG00000174151. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006593. Cyt_b561/ferric_Rdtase_TM. IPR004877. Cyt_b561_euk. [Graphical view] |
| Pfam | PF03188. Cytochrom_B561. 1 hit. [Graphical view] |
| SMART | SM00665. B561. 1 hit. [Graphical view] |
| PROSITE | PS50939. CYTOCHROME_B561. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 284613. |
| NextBio | 95003. |
Entry information
| Entry name | C56D1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N8Q1 Secondary accession number(s): B4DH97, Q52M36, Q5T6C2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
