SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8N8Q1

- C56D1_HUMAN

UniProt

Q8N8Q1 - C56D1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cytochrome b561 domain-containing protein 1

Gene
CYB561D1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Cofactori

Binds 2 heme groups non-covalently By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi55 – 551Iron (heme axial ligand) Reviewed prediction
Metal bindingi93 – 931Iron (heme axial ligand) Reviewed prediction
Metal bindingi127 – 1271Iron (heme axial ligand) Reviewed prediction
Metal bindingi166 – 1661Iron (heme axial ligand) Reviewed prediction

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. oxidation-reduction process Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Electron transport, Transport

Keywords - Ligandi

Heme, Iron, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome b561 domain-containing protein 1
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:26804. CYB561D1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2424Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei25 – 4521Helical; Reviewed predictionAdd
BLAST
Transmembranei54 – 7421Helical; Reviewed predictionAdd
BLAST
Transmembranei92 – 11221Helical; Reviewed predictionAdd
BLAST
Transmembranei129 – 14921Helical; Reviewed predictionAdd
BLAST
Transmembranei170 – 19021Helical; Reviewed predictionAdd
BLAST
Transmembranei194 – 21421Helical; Reviewed predictionAdd
BLAST
Topological domaini215 – 22915Cytoplasmic Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134872038.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 229229Cytochrome b561 domain-containing protein 1PRO_0000151034Add
BLAST

Proteomic databases

MaxQBiQ8N8Q1.
PRIDEiQ8N8Q1.

PTM databases

PhosphoSiteiQ8N8Q1.

Expressioni

Gene expression databases

ArrayExpressiQ8N8Q1.
BgeeiQ8N8Q1.
CleanExiHS_CYB561D1.
GenevestigatoriQ8N8Q1.

Organism-specific databases

HPAiHPA027028.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000358884.

Structurei

3D structure databases

ProteinModelPortaliQ8N8Q1.
SMRiQ8N8Q1. Positions 17-195.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini22 – 224203Cytochrome b561Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG74881.
HOGENOMiHOG000008685.
HOVERGENiHBG050754.
InParanoidiQ8N8Q1.
OMAiFSWHPVF.
OrthoDBiEOG7R2BKS.
PhylomeDBiQ8N8Q1.
TreeFamiTF323584.

Family and domain databases

InterProiIPR006593. Cyt_b561/ferric_Rdtase_TM.
IPR004877. Cyt_b561_euk.
[Graphical view]
PfamiPF03188. Cytochrom_B561. 1 hit.
[Graphical view]
SMARTiSM00665. B561. 1 hit.
[Graphical view]
PROSITEiPS50939. CYTOCHROME_B561. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8N8Q1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MQPLEVGLVP APAGEPRLTR WLRRGSGILA HLVALGFTIF LTALSRPGTS    50
LFSWHPVFMA LAFCLCMAEA ILLFSPEHSL FFFCSRKARI RLHWAGQTLA 100
ILCAALGLGF IISSRTRSEL PHLVSWHSWV GALTLLATAV QALCGLCLLC 150
PRAARVSRVA RLKLYHLTCG LVVYLMATVT VLLGMYSVWF QAQIKGAAWY 200
LCLALPVYPA LVIMHQISRS YLPRKKMEM 229
Length:229
Mass (Da):25,424
Last modified:October 1, 2002 - v1
Checksum:i43978DAF7D8EC218
GO
Isoform 2 (identifier: Q8N8Q1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-133: SLFSWHPVFM...VSWHSWVGAL → KTGPLMEDRS...GSGSTGQGRP
     134-229: Missing.

Show »
Length:133
Mass (Da):14,251
Checksum:i60B7E9CE48574852
GO
Isoform 3 (identifier: Q8N8Q1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-62: SLFSWHPVFMALA → KTGPLMEDRSEGGRARWVMPEIPALWEADAGGSLE

Show »
Length:251
Mass (Da):27,731
Checksum:i9F8B854A243A1492
GO
Isoform 4 (identifier: Q8N8Q1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-229: SLFSWHPVFM...SYLPRKKMEM → KTGPLMEDRS...PMFTVLPLHG

Note: Gene prediction based on EST data.

Show »
Length:128
Mass (Da):14,197
Checksum:iBE94AF3C98A3AB6A
GO
Isoform 5 (identifier: Q8N8Q1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     6-62: Missing.

Note: Gene prediction based on EST data.

Show »
Length:172
Mass (Da):19,314
Checksum:i2665E7E094E494F1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei6 – 6257Missing in isoform 5. VSP_046985Add
BLAST
Alternative sequencei50 – 229180SLFSW…KKMEM → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLEVFSPG TLYSWPWRMYESTSFFSGLQ ARHEAYWLSPMFTVLPLHG in isoform 4. VSP_046986Add
BLAST
Alternative sequencei50 – 13384SLFSW…WVGAL → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLEVFSPG TLYSWPWRSASAWLKPSYSS HLNTPCSSSAPEKHGSGSTG QGRP in isoform 2. VSP_038649Add
BLAST
Alternative sequencei50 – 6213SLFSW…FMALA → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLE in isoform 3. VSP_041162Add
BLAST
Alternative sequencei134 – 22996Missing in isoform 2. VSP_038650Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK096354 mRNA. Translation: BAC04767.1.
AK294992 mRNA. Translation: BAG58058.1.
DA092655 mRNA. No translation available.
AL355145 Genomic DNA. Translation: CAI22940.1.
AL355145 Genomic DNA. Translation: CAI22941.1.
BC093683 mRNA. Translation: AAH93683.1.
BC111999 mRNA. Translation: AAI12000.1.
CCDSiCCDS44188.1. [Q8N8Q1-3]
CCDS44189.1. [Q8N8Q1-5]
CCDS44190.1. [Q8N8Q1-2]
CCDS44191.1. [Q8N8Q1-4]
CCDS800.1. [Q8N8Q1-1]
RefSeqiNP_001127872.1. NM_001134400.1. [Q8N8Q1-3]
NP_001127874.1. NM_001134402.1. [Q8N8Q1-5]
NP_872386.1. NM_182580.2. [Q8N8Q1-1]
UniGeneiHs.514682.

Genome annotation databases

EnsembliENST00000310611; ENSP00000309324; ENSG00000174151. [Q8N8Q1-2]
ENST00000369868; ENSP00000358884; ENSG00000174151. [Q8N8Q1-3]
ENST00000393709; ENSP00000377312; ENSG00000174151. [Q8N8Q1-5]
ENST00000420578; ENSP00000413530; ENSG00000174151. [Q8N8Q1-1]
ENST00000430195; ENSP00000416898; ENSG00000174151. [Q8N8Q1-4]
GeneIDi284613.
KEGGihsa:284613.
UCSCiuc001dxu.3. human. [Q8N8Q1-2]
uc010ovm.2. human. [Q8N8Q1-1]
uc010ovo.2. human. [Q8N8Q1-3]

Polymorphism databases

DMDMi67462193.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK096354 mRNA. Translation: BAC04767.1 .
AK294992 mRNA. Translation: BAG58058.1 .
DA092655 mRNA. No translation available.
AL355145 Genomic DNA. Translation: CAI22940.1 .
AL355145 Genomic DNA. Translation: CAI22941.1 .
BC093683 mRNA. Translation: AAH93683.1 .
BC111999 mRNA. Translation: AAI12000.1 .
CCDSi CCDS44188.1. [Q8N8Q1-3 ]
CCDS44189.1. [Q8N8Q1-5 ]
CCDS44190.1. [Q8N8Q1-2 ]
CCDS44191.1. [Q8N8Q1-4 ]
CCDS800.1. [Q8N8Q1-1 ]
RefSeqi NP_001127872.1. NM_001134400.1. [Q8N8Q1-3 ]
NP_001127874.1. NM_001134402.1. [Q8N8Q1-5 ]
NP_872386.1. NM_182580.2. [Q8N8Q1-1 ]
UniGenei Hs.514682.

3D structure databases

ProteinModelPortali Q8N8Q1.
SMRi Q8N8Q1. Positions 17-195.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 9606.ENSP00000358884.

PTM databases

PhosphoSitei Q8N8Q1.

Polymorphism databases

DMDMi 67462193.

Proteomic databases

MaxQBi Q8N8Q1.
PRIDEi Q8N8Q1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000310611 ; ENSP00000309324 ; ENSG00000174151 . [Q8N8Q1-2 ]
ENST00000369868 ; ENSP00000358884 ; ENSG00000174151 . [Q8N8Q1-3 ]
ENST00000393709 ; ENSP00000377312 ; ENSG00000174151 . [Q8N8Q1-5 ]
ENST00000420578 ; ENSP00000413530 ; ENSG00000174151 . [Q8N8Q1-1 ]
ENST00000430195 ; ENSP00000416898 ; ENSG00000174151 . [Q8N8Q1-4 ]
GeneIDi 284613.
KEGGi hsa:284613.
UCSCi uc001dxu.3. human. [Q8N8Q1-2 ]
uc010ovm.2. human. [Q8N8Q1-1 ]
uc010ovo.2. human. [Q8N8Q1-3 ]

Organism-specific databases

CTDi 284613.
GeneCardsi GC01P110036.
HGNCi HGNC:26804. CYB561D1.
HPAi HPA027028.
neXtProti NX_Q8N8Q1.
PharmGKBi PA134872038.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG74881.
HOGENOMi HOG000008685.
HOVERGENi HBG050754.
InParanoidi Q8N8Q1.
OMAi FSWHPVF.
OrthoDBi EOG7R2BKS.
PhylomeDBi Q8N8Q1.
TreeFami TF323584.

Miscellaneous databases

GenomeRNAii 284613.
NextBioi 95003.
PROi Q8N8Q1.

Gene expression databases

ArrayExpressi Q8N8Q1.
Bgeei Q8N8Q1.
CleanExi HS_CYB561D1.
Genevestigatori Q8N8Q1.

Family and domain databases

InterProi IPR006593. Cyt_b561/ferric_Rdtase_TM.
IPR004877. Cyt_b561_euk.
[Graphical view ]
Pfami PF03188. Cytochrom_B561. 1 hit.
[Graphical view ]
SMARTi SM00665. B561. 1 hit.
[Graphical view ]
PROSITEi PS50939. CYTOCHROME_B561. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Liver.

Entry informationi

Entry nameiC56D1_HUMAN
AccessioniPrimary (citable) accession number: Q8N8Q1
Secondary accession number(s): B4DH97
, E9PCM8, Q52M36, Q5T6C2, Q5T6C3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: October 1, 2002
Last modified: July 9, 2014
This is version 93 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi