Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytochrome b561 domain-containing protein 1

Gene

CYB561D1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Cofactori

hemeBy similarityNote: Binds 2 heme groups non-covalently.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi55Iron (heme axial ligand)PROSITE-ProRule annotation1
Metal bindingi93Iron (heme axial ligand)PROSITE-ProRule annotation1
Metal bindingi127Iron (heme axial ligand)PROSITE-ProRule annotation1
Metal bindingi166Iron (heme axial ligand)PROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Electron transport, Transport

Keywords - Ligandi

Heme, Iron, Metal-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000174151-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome b561 domain-containing protein 1
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:26804. CYB561D1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 24CytoplasmicSequence analysisAdd BLAST24
Transmembranei25 – 45HelicalSequence analysisAdd BLAST21
Transmembranei54 – 74HelicalSequence analysisAdd BLAST21
Transmembranei92 – 112HelicalSequence analysisAdd BLAST21
Transmembranei129 – 149HelicalSequence analysisAdd BLAST21
Transmembranei170 – 190HelicalSequence analysisAdd BLAST21
Transmembranei194 – 214HelicalSequence analysisAdd BLAST21
Topological domaini215 – 229CytoplasmicSequence analysisAdd BLAST15

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi284613.
OpenTargetsiENSG00000174151.
PharmGKBiPA134872038.

Polymorphism and mutation databases

BioMutaiCYB561D1.
DMDMi67462193.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001510341 – 229Cytochrome b561 domain-containing protein 1Add BLAST229

Proteomic databases

MaxQBiQ8N8Q1.
PRIDEiQ8N8Q1.
TopDownProteomicsiQ8N8Q1-1. [Q8N8Q1-1]

PTM databases

iPTMnetiQ8N8Q1.
PhosphoSitePlusiQ8N8Q1.

Expressioni

Gene expression databases

BgeeiENSG00000174151.
CleanExiHS_CYB561D1.
ExpressionAtlasiQ8N8Q1. baseline and differential.
GenevisibleiQ8N8Q1. HS.

Organism-specific databases

HPAiHPA027028.

Structurei

3D structure databases

ProteinModelPortaliQ8N8Q1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini22 – 224Cytochrome b561PROSITE-ProRule annotationAdd BLAST203

Sequence similaritiesi

Contains 1 cytochrome b561 domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00440000038072.
HOGENOMiHOG000008685.
HOVERGENiHBG050754.
InParanoidiQ8N8Q1.
OMAiFCLCMAE.
OrthoDBiEOG091G0OYU.
PhylomeDBiQ8N8Q1.
TreeFamiTF323584.

Family and domain databases

InterProiIPR006593. Cyt_b561/ferric_Rdtase_TM.
[Graphical view]
PfamiPF03188. Cytochrom_B561. 1 hit.
[Graphical view]
SMARTiSM00665. B561. 1 hit.
[Graphical view]
PROSITEiPS50939. CYTOCHROME_B561. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N8Q1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQPLEVGLVP APAGEPRLTR WLRRGSGILA HLVALGFTIF LTALSRPGTS
60 70 80 90 100
LFSWHPVFMA LAFCLCMAEA ILLFSPEHSL FFFCSRKARI RLHWAGQTLA
110 120 130 140 150
ILCAALGLGF IISSRTRSEL PHLVSWHSWV GALTLLATAV QALCGLCLLC
160 170 180 190 200
PRAARVSRVA RLKLYHLTCG LVVYLMATVT VLLGMYSVWF QAQIKGAAWY
210 220
LCLALPVYPA LVIMHQISRS YLPRKKMEM
Length:229
Mass (Da):25,424
Last modified:October 1, 2002 - v1
Checksum:i43978DAF7D8EC218
GO
Isoform 2 (identifier: Q8N8Q1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-133: SLFSWHPVFM...VSWHSWVGAL → KTGPLMEDRS...GSGSTGQGRP
     134-229: Missing.

Show »
Length:133
Mass (Da):14,251
Checksum:i60B7E9CE48574852
GO
Isoform 3 (identifier: Q8N8Q1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-62: SLFSWHPVFMALA → KTGPLMEDRSEGGRARWVMPEIPALWEADAGGSLE

Show »
Length:251
Mass (Da):27,731
Checksum:i9F8B854A243A1492
GO
Isoform 4 (identifier: Q8N8Q1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-229: SLFSWHPVFM...SYLPRKKMEM → KTGPLMEDRS...PMFTVLPLHG

Note: Gene prediction based on EST data.
Show »
Length:128
Mass (Da):14,197
Checksum:iBE94AF3C98A3AB6A
GO
Isoform 5 (identifier: Q8N8Q1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     6-62: Missing.

Note: Gene prediction based on EST data.
Show »
Length:172
Mass (Da):19,314
Checksum:i2665E7E094E494F1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0469856 – 62Missing in isoform 5. CuratedAdd BLAST57
Alternative sequenceiVSP_04698650 – 229SLFSW…KKMEM → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLEVFSPG TLYSWPWRMYESTSFFSGLQ ARHEAYWLSPMFTVLPLHG in isoform 4. CuratedAdd BLAST180
Alternative sequenceiVSP_03864950 – 133SLFSW…WVGAL → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLEVFSPG TLYSWPWRSASAWLKPSYSS HLNTPCSSSAPEKHGSGSTG QGRP in isoform 2. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_04116250 – 62SLFSW…FMALA → KTGPLMEDRSEGGRARWVMP EIPALWEADAGGSLE in isoform 3. 1 PublicationAdd BLAST13
Alternative sequenceiVSP_038650134 – 229Missing in isoform 2. 1 PublicationAdd BLAST96

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK096354 mRNA. Translation: BAC04767.1.
AK294992 mRNA. Translation: BAG58058.1.
DA092655 mRNA. No translation available.
AL355145 Genomic DNA. Translation: CAI22940.1.
AL355145 Genomic DNA. Translation: CAI22941.1.
BC093683 mRNA. Translation: AAH93683.1.
BC111999 mRNA. Translation: AAI12000.1.
CCDSiCCDS44188.1. [Q8N8Q1-3]
CCDS44189.1. [Q8N8Q1-5]
CCDS44190.1. [Q8N8Q1-2]
CCDS44191.1. [Q8N8Q1-4]
CCDS800.1. [Q8N8Q1-1]
RefSeqiNP_001127872.1. NM_001134400.1. [Q8N8Q1-3]
NP_001127874.1. NM_001134402.1. [Q8N8Q1-5]
NP_872386.1. NM_182580.2. [Q8N8Q1-1]
UniGeneiHs.514682.

Genome annotation databases

EnsembliENST00000310611; ENSP00000309324; ENSG00000174151. [Q8N8Q1-2]
ENST00000369868; ENSP00000358884; ENSG00000174151. [Q8N8Q1-3]
ENST00000393709; ENSP00000377312; ENSG00000174151. [Q8N8Q1-5]
ENST00000420578; ENSP00000413530; ENSG00000174151. [Q8N8Q1-1]
ENST00000430195; ENSP00000416898; ENSG00000174151. [Q8N8Q1-4]
GeneIDi284613.
KEGGihsa:284613.
UCSCiuc001dxu.4. human. [Q8N8Q1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK096354 mRNA. Translation: BAC04767.1.
AK294992 mRNA. Translation: BAG58058.1.
DA092655 mRNA. No translation available.
AL355145 Genomic DNA. Translation: CAI22940.1.
AL355145 Genomic DNA. Translation: CAI22941.1.
BC093683 mRNA. Translation: AAH93683.1.
BC111999 mRNA. Translation: AAI12000.1.
CCDSiCCDS44188.1. [Q8N8Q1-3]
CCDS44189.1. [Q8N8Q1-5]
CCDS44190.1. [Q8N8Q1-2]
CCDS44191.1. [Q8N8Q1-4]
CCDS800.1. [Q8N8Q1-1]
RefSeqiNP_001127872.1. NM_001134400.1. [Q8N8Q1-3]
NP_001127874.1. NM_001134402.1. [Q8N8Q1-5]
NP_872386.1. NM_182580.2. [Q8N8Q1-1]
UniGeneiHs.514682.

3D structure databases

ProteinModelPortaliQ8N8Q1.
ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiQ8N8Q1.
PhosphoSitePlusiQ8N8Q1.

Polymorphism and mutation databases

BioMutaiCYB561D1.
DMDMi67462193.

Proteomic databases

MaxQBiQ8N8Q1.
PRIDEiQ8N8Q1.
TopDownProteomicsiQ8N8Q1-1. [Q8N8Q1-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000310611; ENSP00000309324; ENSG00000174151. [Q8N8Q1-2]
ENST00000369868; ENSP00000358884; ENSG00000174151. [Q8N8Q1-3]
ENST00000393709; ENSP00000377312; ENSG00000174151. [Q8N8Q1-5]
ENST00000420578; ENSP00000413530; ENSG00000174151. [Q8N8Q1-1]
ENST00000430195; ENSP00000416898; ENSG00000174151. [Q8N8Q1-4]
GeneIDi284613.
KEGGihsa:284613.
UCSCiuc001dxu.4. human. [Q8N8Q1-1]

Organism-specific databases

CTDi284613.
DisGeNETi284613.
GeneCardsiCYB561D1.
HGNCiHGNC:26804. CYB561D1.
HPAiHPA027028.
neXtProtiNX_Q8N8Q1.
OpenTargetsiENSG00000174151.
PharmGKBiPA134872038.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00440000038072.
HOGENOMiHOG000008685.
HOVERGENiHBG050754.
InParanoidiQ8N8Q1.
OMAiFCLCMAE.
OrthoDBiEOG091G0OYU.
PhylomeDBiQ8N8Q1.
TreeFamiTF323584.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000174151-MONOMER.

Miscellaneous databases

ChiTaRSiCYB561D1. human.
GenomeRNAii284613.
PROiQ8N8Q1.

Gene expression databases

BgeeiENSG00000174151.
CleanExiHS_CYB561D1.
ExpressionAtlasiQ8N8Q1. baseline and differential.
GenevisibleiQ8N8Q1. HS.

Family and domain databases

InterProiIPR006593. Cyt_b561/ferric_Rdtase_TM.
[Graphical view]
PfamiPF03188. Cytochrom_B561. 1 hit.
[Graphical view]
SMARTiSM00665. B561. 1 hit.
[Graphical view]
PROSITEiPS50939. CYTOCHROME_B561. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiC56D1_HUMAN
AccessioniPrimary (citable) accession number: Q8N8Q1
Secondary accession number(s): B4DH97
, E9PCM8, Q52M36, Q5T6C2, Q5T6C3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: October 1, 2002
Last modified: November 2, 2016
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.