Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription elongation factor A N-terminal and central domain-containing protein

Gene

TCEANC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription elongation factor A N-terminal and central domain-containing protein
Alternative name(s):
TFIIS central domain-containing protein 1
Gene namesi
Name:TCEANC
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:28277. TCEANC.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Polymorphism and mutation databases

BioMutaiTCEANC.
DMDMi117949797.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 351351Transcription elongation factor A N-terminal and central domain-containing proteinPRO_0000259659Add
BLAST

Proteomic databases

PaxDbiQ8N8B7.
PeptideAtlasiQ8N8B7.
PRIDEiQ8N8B7.

PTM databases

iPTMnetiQ8N8B7.
PhosphoSiteiQ8N8B7.

Expressioni

Gene expression databases

BgeeiENSG00000176896.
ExpressionAtlasiQ8N8B7. baseline and differential.
GenevisibleiQ8N8B7. HS.

Organism-specific databases

HPAiHPA001013.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CARD9Q9H2573EBI-954696,EBI-751319
CRACR2BQ8N4Y23EBI-954696,EBI-10267893
CSRNP1Q96S653EBI-954696,EBI-4311573
DAB1O755533EBI-954696,EBI-7875264
FAM9BQ8IZU03EBI-954696,EBI-10175124
FSBPO950733EBI-954696,EBI-1059030
FSD2A1L4K13EBI-954696,EBI-5661036
GOLGA2Q083793EBI-954696,EBI-618309
HMBOX1Q6NT763EBI-954696,EBI-2549423
KIFC3Q9BVG83EBI-954696,EBI-2125614
KRTAP10-7P604093EBI-954696,EBI-10172290
KRTAP4-2Q9BYR53EBI-954696,EBI-10172511
KRTAP5-9P263713EBI-954696,EBI-3958099
MEOX1P502213EBI-954696,EBI-2864512
MID1O153443EBI-954696,EBI-2340316
NAB2Q157423EBI-954696,EBI-8641936
PNMA1Q8ND903EBI-954696,EBI-302345
RNF219Q5W0B13EBI-954696,EBI-2562035
SPERTQ8NA613EBI-954696,EBI-741724
SSNA1O438053EBI-954696,EBI-2515299
TARBP2Q156333EBI-954696,EBI-978581
VAC14Q08AM63EBI-954696,EBI-2107455
VPS52Q8N1B43EBI-954696,EBI-2799833
ZBTB14O438293EBI-954696,EBI-10176632

Protein-protein interaction databases

BioGridi127996. 37 interactions.
IntActiQ8N8B7. 26 interactions.
MINTiMINT-1468129.
STRINGi9606.ENSP00000313886.

Structurei

3D structure databases

ProteinModelPortaliQ8N8B7.
SMRiQ8N8B7. Positions 173-274.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini5 – 8278TFIIS N-terminalPROSITE-ProRule annotationAdd
BLAST
Domaini173 – 289117TFIIS centralPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 TFIIS central domain.PROSITE-ProRule annotation
Contains 1 TFIIS N-terminal domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1105. Eukaryota.
COG1594. LUCA.
GeneTreeiENSGT00390000017794.
HOGENOMiHOG000234470.
InParanoidiQ8N8B7.
OMAiLKNCPSV.
OrthoDBiEOG091G08RS.
PhylomeDBiQ8N8B7.
TreeFamiTF314970.

Family and domain databases

Gene3Di1.10.472.30. 1 hit.
1.20.930.10. 1 hit.
InterProiIPR016492. TF_IIS-rel.
IPR003618. TFIIS_cen_dom.
IPR017923. TFIIS_N.
[Graphical view]
PfamiPF08711. Med26. 1 hit.
PF07500. TFIIS_M. 1 hit.
[Graphical view]
PIRSFiPIRSF006704. TF_IIS. 1 hit.
SMARTiSM00510. TFS2M. 1 hit.
[Graphical view]
SUPFAMiSSF46942. SSF46942. 1 hit.
SSF47676. SSF47676. 1 hit.
PROSITEiPS51321. TFIIS_CENTRAL. 1 hit.
PS51319. TFIIS_N. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N8B7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDKNQIAAR ASLIEQLMSK RNFEDLGNHL TELETIYVTK EHLQETDVVR
60 70 80 90 100
AVYRVLKNCP SVALKKKAKC LLSKWKAVYK QTHSKARNSP KLFPVRGNKE
110 120 130 140 150
ENSGPSHDPS QNETLGICSS NSLSSQDVAK LSEMIVPENR AIQLKPKEEH
160 170 180 190 200
FGDGDPESTG KRSSELLDPT TPMRTKCIEL LYAALTSSST DQPKADLWQN
210 220 230 240 250
FAREIEEHVF TLYSKNIKKY KTCIRSKVAN LKNPRNSHLQ QNLLSGTTSP
260 270 280 290 300
REFAEMTVME MANKELKQLR ASYTESCIQE HYLPQVIDGT QTNKIKCRRC
310 320 330 340 350
EKYNCKVTVI DRGTLFLPSW VRNSNPDEQM MTYVICNECG EQWYHSKWVC

W
Length:351
Mass (Da):40,245
Last modified:October 31, 2006 - v2
Checksum:iC48E135BCDC27B9E
GO
Isoform 2 (identifier: Q8N8B7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MISAHRKLCLPGSSNSPASAFRVAGTTAVKM

Show »
Length:381
Mass (Da):43,285
Checksum:i49D59A9DD90A66D3
GO

Sequence cautioni

The sequence BAC04930 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti163 – 1631S → L.1 Publication
Corresponds to variant rs2361159 [ dbSNP | Ensembl ].
VAR_028970

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MISAHRKLCLPGSSNSPASA FRVAGTTAVKM in isoform 2. 1 PublicationVSP_039895

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097032 mRNA. Translation: BAC04930.1. Different initiation.
AK315599 mRNA. Translation: BAG37970.1.
DC344354 mRNA. No translation available.
AC079383 Genomic DNA. No translation available.
BC020095 mRNA. No translation available.
CCDSiCCDS48081.1. [Q8N8B7-2]
CCDS75954.1. [Q8N8B7-1]
RefSeqiNP_001284492.1. NM_001297563.1. [Q8N8B7-1]
NP_001284493.1. NM_001297564.1. [Q8N8B7-1]
UniGeneiHs.222855.
Hs.737398.

Genome annotation databases

EnsembliENST00000380600; ENSP00000369974; ENSG00000176896. [Q8N8B7-1]
ENST00000544987; ENSP00000440038; ENSG00000176896. [Q8N8B7-2]
GeneIDi170082.
KEGGihsa:170082.
UCSCiuc064yao.1. human. [Q8N8B7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097032 mRNA. Translation: BAC04930.1. Different initiation.
AK315599 mRNA. Translation: BAG37970.1.
DC344354 mRNA. No translation available.
AC079383 Genomic DNA. No translation available.
BC020095 mRNA. No translation available.
CCDSiCCDS48081.1. [Q8N8B7-2]
CCDS75954.1. [Q8N8B7-1]
RefSeqiNP_001284492.1. NM_001297563.1. [Q8N8B7-1]
NP_001284493.1. NM_001297564.1. [Q8N8B7-1]
UniGeneiHs.222855.
Hs.737398.

3D structure databases

ProteinModelPortaliQ8N8B7.
SMRiQ8N8B7. Positions 173-274.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127996. 37 interactions.
IntActiQ8N8B7. 26 interactions.
MINTiMINT-1468129.
STRINGi9606.ENSP00000313886.

PTM databases

iPTMnetiQ8N8B7.
PhosphoSiteiQ8N8B7.

Polymorphism and mutation databases

BioMutaiTCEANC.
DMDMi117949797.

Proteomic databases

PaxDbiQ8N8B7.
PeptideAtlasiQ8N8B7.
PRIDEiQ8N8B7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380600; ENSP00000369974; ENSG00000176896. [Q8N8B7-1]
ENST00000544987; ENSP00000440038; ENSG00000176896. [Q8N8B7-2]
GeneIDi170082.
KEGGihsa:170082.
UCSCiuc064yao.1. human. [Q8N8B7-1]

Organism-specific databases

CTDi170082.
GeneCardsiTCEANC.
HGNCiHGNC:28277. TCEANC.
HPAiHPA001013.
neXtProtiNX_Q8N8B7.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1105. Eukaryota.
COG1594. LUCA.
GeneTreeiENSGT00390000017794.
HOGENOMiHOG000234470.
InParanoidiQ8N8B7.
OMAiLKNCPSV.
OrthoDBiEOG091G08RS.
PhylomeDBiQ8N8B7.
TreeFamiTF314970.

Miscellaneous databases

ChiTaRSiTCEANC. human.
GenomeRNAii170082.
PROiQ8N8B7.

Gene expression databases

BgeeiENSG00000176896.
ExpressionAtlasiQ8N8B7. baseline and differential.
GenevisibleiQ8N8B7. HS.

Family and domain databases

Gene3Di1.10.472.30. 1 hit.
1.20.930.10. 1 hit.
InterProiIPR016492. TF_IIS-rel.
IPR003618. TFIIS_cen_dom.
IPR017923. TFIIS_N.
[Graphical view]
PfamiPF08711. Med26. 1 hit.
PF07500. TFIIS_M. 1 hit.
[Graphical view]
PIRSFiPIRSF006704. TF_IIS. 1 hit.
SMARTiSM00510. TFS2M. 1 hit.
[Graphical view]
SUPFAMiSSF46942. SSF46942. 1 hit.
SSF47676. SSF47676. 1 hit.
PROSITEiPS51321. TFIIS_CENTRAL. 1 hit.
PS51319. TFIIS_N. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTEANC_HUMAN
AccessioniPrimary (citable) accession number: Q8N8B7
Secondary accession number(s): A6NI06, B2RDM3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: September 7, 2016
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.