Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transcription elongation factor A N-terminal and central domain-containing protein

Gene

TCEANC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Transcription elongation factor A N-terminal and central domain-containing protein
Alternative name(s):
TFIIS central domain-containing protein 1
Gene namesi
Name:TCEANC
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:28277. TCEANC.

Subcellular locationi

GO - Cellular componenti

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000176896.

Polymorphism and mutation databases

BioMutaiTCEANC.
DMDMi117949797.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002596591 – 351Transcription elongation factor A N-terminal and central domain-containing proteinAdd BLAST351

Proteomic databases

PaxDbiQ8N8B7.
PeptideAtlasiQ8N8B7.
PRIDEiQ8N8B7.

PTM databases

iPTMnetiQ8N8B7.
PhosphoSitePlusiQ8N8B7.

Expressioni

Gene expression databases

BgeeiENSG00000176896.
ExpressionAtlasiQ8N8B7. baseline and differential.
GenevisibleiQ8N8B7. HS.

Organism-specific databases

HPAiHPA001013.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi127996. 38 interactors.
IntActiQ8N8B7. 104 interactors.
MINTiMINT-1468129.
STRINGi9606.ENSP00000313886.

Structurei

3D structure databases

ProteinModelPortaliQ8N8B7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini5 – 82TFIIS N-terminalPROSITE-ProRule annotationAdd BLAST78
Domaini173 – 289TFIIS centralPROSITE-ProRule annotationAdd BLAST117

Phylogenomic databases

eggNOGiKOG1105. Eukaryota.
COG1594. LUCA.
GeneTreeiENSGT00390000017794.
HOGENOMiHOG000234470.
InParanoidiQ8N8B7.
OMAiLKNCPSV.
OrthoDBiEOG091G08RS.
PhylomeDBiQ8N8B7.
TreeFamiTF314970.

Family and domain databases

Gene3Di1.10.472.30. 1 hit.
1.20.930.10. 1 hit.
InterProiView protein in InterPro
IPR003618. TFIIS_cen_dom.
IPR017923. TFIIS_N.
IPR006289. TFSII.
PfamiView protein in Pfam
PF08711. Med26. 1 hit.
PF07500. TFIIS_M. 1 hit.
PIRSFiPIRSF006704. TF_IIS. 1 hit.
SMARTiView protein in SMART
SM00510. TFS2M. 1 hit.
SUPFAMiSSF46942. SSF46942. 1 hit.
SSF47676. SSF47676. 1 hit.
PROSITEiView protein in PROSITE
PS51321. TFIIS_CENTRAL. 1 hit.
PS51319. TFIIS_N. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N8B7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDKNQIAAR ASLIEQLMSK RNFEDLGNHL TELETIYVTK EHLQETDVVR
60 70 80 90 100
AVYRVLKNCP SVALKKKAKC LLSKWKAVYK QTHSKARNSP KLFPVRGNKE
110 120 130 140 150
ENSGPSHDPS QNETLGICSS NSLSSQDVAK LSEMIVPENR AIQLKPKEEH
160 170 180 190 200
FGDGDPESTG KRSSELLDPT TPMRTKCIEL LYAALTSSST DQPKADLWQN
210 220 230 240 250
FAREIEEHVF TLYSKNIKKY KTCIRSKVAN LKNPRNSHLQ QNLLSGTTSP
260 270 280 290 300
REFAEMTVME MANKELKQLR ASYTESCIQE HYLPQVIDGT QTNKIKCRRC
310 320 330 340 350
EKYNCKVTVI DRGTLFLPSW VRNSNPDEQM MTYVICNECG EQWYHSKWVC

W
Length:351
Mass (Da):40,245
Last modified:October 31, 2006 - v2
Checksum:iC48E135BCDC27B9E
GO
Isoform 2 (identifier: Q8N8B7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MISAHRKLCLPGSSNSPASAFRVAGTTAVKM

Show »
Length:381
Mass (Da):43,285
Checksum:i49D59A9DD90A66D3
GO

Sequence cautioni

The sequence BAC04930 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_028970163S → L1 PublicationCorresponds to variant dbSNP:rs2361159Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0398951M → MISAHRKLCLPGSSNSPASA FRVAGTTAVKM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097032 mRNA. Translation: BAC04930.1. Different initiation.
AK315599 mRNA. Translation: BAG37970.1.
DC344354 mRNA. No translation available.
AC079383 Genomic DNA. No translation available.
BC020095 mRNA. No translation available.
CCDSiCCDS48081.1. [Q8N8B7-2]
CCDS75954.1. [Q8N8B7-1]
RefSeqiNP_001284492.1. NM_001297563.1. [Q8N8B7-1]
NP_001284493.1. NM_001297564.1. [Q8N8B7-1]
XP_016884805.1. XM_017029316.1. [Q8N8B7-2]
XP_016884806.1. XM_017029317.1. [Q8N8B7-1]
XP_016884807.1. XM_017029318.1. [Q8N8B7-1]
XP_016884808.1. XM_017029319.1. [Q8N8B7-1]
UniGeneiHs.222855.
Hs.737398.

Genome annotation databases

EnsembliENST00000380600; ENSP00000369974; ENSG00000176896. [Q8N8B7-1]
ENST00000544987; ENSP00000440038; ENSG00000176896. [Q8N8B7-2]
GeneIDi170082.
KEGGihsa:170082.
UCSCiuc064yao.1. human. [Q8N8B7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097032 mRNA. Translation: BAC04930.1. Different initiation.
AK315599 mRNA. Translation: BAG37970.1.
DC344354 mRNA. No translation available.
AC079383 Genomic DNA. No translation available.
BC020095 mRNA. No translation available.
CCDSiCCDS48081.1. [Q8N8B7-2]
CCDS75954.1. [Q8N8B7-1]
RefSeqiNP_001284492.1. NM_001297563.1. [Q8N8B7-1]
NP_001284493.1. NM_001297564.1. [Q8N8B7-1]
XP_016884805.1. XM_017029316.1. [Q8N8B7-2]
XP_016884806.1. XM_017029317.1. [Q8N8B7-1]
XP_016884807.1. XM_017029318.1. [Q8N8B7-1]
XP_016884808.1. XM_017029319.1. [Q8N8B7-1]
UniGeneiHs.222855.
Hs.737398.

3D structure databases

ProteinModelPortaliQ8N8B7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127996. 38 interactors.
IntActiQ8N8B7. 104 interactors.
MINTiMINT-1468129.
STRINGi9606.ENSP00000313886.

PTM databases

iPTMnetiQ8N8B7.
PhosphoSitePlusiQ8N8B7.

Polymorphism and mutation databases

BioMutaiTCEANC.
DMDMi117949797.

Proteomic databases

PaxDbiQ8N8B7.
PeptideAtlasiQ8N8B7.
PRIDEiQ8N8B7.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380600; ENSP00000369974; ENSG00000176896. [Q8N8B7-1]
ENST00000544987; ENSP00000440038; ENSG00000176896. [Q8N8B7-2]
GeneIDi170082.
KEGGihsa:170082.
UCSCiuc064yao.1. human. [Q8N8B7-1]

Organism-specific databases

CTDi170082.
GeneCardsiTCEANC.
HGNCiHGNC:28277. TCEANC.
HPAiHPA001013.
neXtProtiNX_Q8N8B7.
OpenTargetsiENSG00000176896.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1105. Eukaryota.
COG1594. LUCA.
GeneTreeiENSGT00390000017794.
HOGENOMiHOG000234470.
InParanoidiQ8N8B7.
OMAiLKNCPSV.
OrthoDBiEOG091G08RS.
PhylomeDBiQ8N8B7.
TreeFamiTF314970.

Miscellaneous databases

ChiTaRSiTCEANC. human.
GenomeRNAii170082.
PROiPR:Q8N8B7.

Gene expression databases

BgeeiENSG00000176896.
ExpressionAtlasiQ8N8B7. baseline and differential.
GenevisibleiQ8N8B7. HS.

Family and domain databases

Gene3Di1.10.472.30. 1 hit.
1.20.930.10. 1 hit.
InterProiView protein in InterPro
IPR003618. TFIIS_cen_dom.
IPR017923. TFIIS_N.
IPR006289. TFSII.
PfamiView protein in Pfam
PF08711. Med26. 1 hit.
PF07500. TFIIS_M. 1 hit.
PIRSFiPIRSF006704. TF_IIS. 1 hit.
SMARTiView protein in SMART
SM00510. TFS2M. 1 hit.
SUPFAMiSSF46942. SSF46942. 1 hit.
SSF47676. SSF47676. 1 hit.
PROSITEiView protein in PROSITE
PS51321. TFIIS_CENTRAL. 1 hit.
PS51319. TFIIS_N. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiTEANC_HUMAN
AccessioniPrimary (citable) accession number: Q8N8B7
Secondary accession number(s): A6NI06, B2RDM3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: April 12, 2017
This is version 124 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.