Q8N7R7 (CCYL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 85.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Cyclin-Y-like protein 1 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 359 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Belongs to the cyclin family. Cyclin Y subfamily. Contains 1 cyclin N-terminal domain. |
| Sequence caution | The sequence AAH67253.1 differs from that shown. Reason: Frameshift at position 47. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Molecular function | Cyclin |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | regulation of cyclin-dependent protein serine/threonine kinase activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N7R7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N7R7-2) The sequence of this isoform differs from the canonical sequence as follows: 111-173: VSPGQLTKKYSSCSTIFLDDSTVSQPNLRTTVKCVTLAIYYHIKNRDANRSLDIFDERSHPLT → CDLSNILPHKEQ | ||||||
| Isoform 3 (identifier: Q8N7R7-3) The sequence of this isoform differs from the canonical sequence as follows: 1-70: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 359 | 359 | Cyclin-Y-like protein 1 | PRO_0000309321 | |||||
Regions | |||||||||
| Domain | 145 – 267 | 123 | Cyclin N-terminal | ||||||
Amino acid modifications | |||||||||
| Modified residue | 105 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 112 | 1 | Phosphoserine Ref.9 Ref.10 | ||||||
| Modified residue | 344 | 1 | Phosphoserine Ref.6 Ref.8 Ref.9 Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 70 | 70 | Missing in isoform 3. | VSP_029133 | |||||
| Alternative sequence | 111 – 173 | 63 | VSPGQ…SHPLT → CDLSNILPHKEQ in isoform 2. | VSP_029134 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Testis. |
| [2] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Uterus. |
| [5] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [8] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [9] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-112 AND SER-344, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-105; SER-112 AND SER-344, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK097751 mRNA. Translation: BAC05160.1. AC096772 Genomic DNA. Translation: AAY24056.1. CH471063 Genomic DNA. Translation: EAW70420.1. BC067253 mRNA. Translation: AAH67253.1. Frameshift. |
| IPI | IPI00185371. IPI00413695. IPI00871180. |
| RefSeq | NP_001135772.1. NM_001142300.1. NP_689736.1. NM_152523.2. |
| UniGene | Hs.471234. Hs.597952. |
3D structure databases | |
| ProteinModelPortal | Q8N7R7. |
| SMR | Q8N7R7. Positions 178-296. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000342344. |
PTM databases | |
| PhosphoSite | Q8N7R7. |
Polymorphism databases | |
| DMDM | 160380580. |
Proteomic databases | |
| PaxDb | Q8N7R7. |
| PRIDE | Q8N7R7. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000295414; ENSP00000295414; ENSG00000163249. ENST00000339882; ENSP00000342344; ENSG00000163249. ENST00000392209; ENSP00000376045; ENSG00000163249. |
| GeneID | 151195. |
| KEGG | hsa:151195. |
| UCSC | uc002vch.3. human. uc002vci.3. human. |
Organism-specific databases | |
| CTD | 151195. |
| GeneCards | GC02P208576. |
| HGNC | HGNC:26868. CCNYL1. |
| HPA | HPA046825. |
| neXtProt | NX_Q8N7R7. |
| PharmGKB | PA162382009. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG303674. |
| HOGENOM | HOG000021397. |
| HOVERGEN | HBG058985. |
| InParanoid | Q8N7R7. |
| OMA | TREEVPD. |
Gene expression databases | |
| ArrayExpress | Q8N7R7. |
| Bgee | Q8N7R7. |
| CleanEx | HS_CCNYL1. |
| Genevestigator | Q8N7R7. |
Family and domain databases | |
| Gene3D | 1.10.472.10. 1 hit. |
| InterPro | IPR013763. Cyclin-like. IPR006671. Cyclin_N. IPR012399. Cyclin_Y. [Graphical view] |
| Pfam | PF00134. Cyclin_N. 1 hit. [Graphical view] |
| PIRSF | PIRSF028934. Cyclin_CG14939. 1 hit. |
| SMART | SM00385. CYCLIN. 1 hit. [Graphical view] |
| SUPFAM | SSF47954. Cyclin_like. 1 hit. |
| PROSITE | PS00292. CYCLINS. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 151195. |
| NextBio | 86620. |
Entry information
| Entry name | CCYL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N7R7 Secondary accession number(s): Q6NX60 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
