Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-Y-like protein 1

Gene

CCNYL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionCyclin

Enzyme and pathway databases

SignaLinkiQ8N7R7

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-Y-like protein 1
Gene namesi
Name:CCNYL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000163249.9
HGNCiHGNC:26868 CCNYL1
neXtProtiNX_Q8N7R7

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000163249
PharmGKBiPA162382009

Polymorphism and mutation databases

BioMutaiCCNYL1
DMDMi160380580

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003093211 – 359Cyclin-Y-like protein 1Add BLAST359

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei67PhosphoserineCombined sources1
Modified residuei105PhosphoserineCombined sources1
Modified residuei112PhosphoserineCombined sources1
Modified residuei344PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ8N7R7
MaxQBiQ8N7R7
PeptideAtlasiQ8N7R7
PRIDEiQ8N7R7

PTM databases

iPTMnetiQ8N7R7
PhosphoSitePlusiQ8N7R7
SwissPalmiQ8N7R7

Expressioni

Gene expression databases

BgeeiENSG00000163249
CleanExiHS_CCNYL1
ExpressionAtlasiQ8N7R7 baseline and differential
GenevisibleiQ8N7R7 HS

Organism-specific databases

HPAiHPA046825

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CDK16Q005363EBI-10103094,EBI-726261

GO - Molecular functioni

Protein-protein interaction databases

BioGridi12735342 interactors.
IntActiQ8N7R7 6 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ8N7R7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini145 – 267Cyclin N-terminalAdd BLAST123

Sequence similaritiesi

Belongs to the cyclin family. Cyclin Y subfamily.Curated

Phylogenomic databases

GeneTreeiENSGT00390000006626
HOGENOMiHOG000021397
HOVERGENiHBG058985
InParanoidiQ8N7R7
OMAiTREEVPD
OrthoDBiEOG091G0BM9
PhylomeDBiQ8N7R7
TreeFamiTF314464

Family and domain databases

CDDicd00043 CYCLIN, 1 hit
InterProiView protein in InterPro
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR006671 Cyclin_N
IPR012399 Cyclin_Y
PfamiView protein in Pfam
PF00134 Cyclin_N, 1 hit
PIRSFiPIRSF028934 Cyclin_CG14939, 1 hit
SMARTiView protein in SMART
SM00385 CYCLIN, 1 hit
SUPFAMiSSF47954 SSF47954, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N7R7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNTLTCCVS PNASPKLGRR AGSAELYCAS DIYEAVSGDA VAVAPAVVEP
60 70 80 90 100
AELDFGEGEG HHLQHISDRE MPEDLALESN PSDHPRASTI FLSKSQTDVR
110 120 130 140 150
EKRKSNHLNH VSPGQLTKKY SSCSTIFLDD STVSQPNLRT TVKCVTLAIY
160 170 180 190 200
YHIKNRDANR SLDIFDERSH PLTREKVPEE YFKHDPEHKF IYRFVRTLFS
210 220 230 240 250
AAQLTAECAI VTLVYLERLL TYAEIDICPT NWKRIVLGAI LLASKVWDDQ
260 270 280 290 300
AVWNVDYCQI LKDITVEDMN EMERHFLELL QFNINVPASV YAKYYFDLRS
310 320 330 340 350
LADDNNLNFL FAPLSKERAQ NLEAISRLCE DKDLCRAAMR RSFSADNFIG

IQRSKAILS
Length:359
Mass (Da):40,705
Last modified:November 13, 2007 - v2
Checksum:i76381F33FE5C890C
GO
Isoform 2 (identifier: Q8N7R7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-173: VSPGQLTKKYSSCSTIFLDDSTVSQPNLRTTVKCVTLAIYYHIKNRDANRSLDIFDERSHPLT → CDLSNILPHKEQ

Show »
Length:308
Mass (Da):34,956
Checksum:i2A39C7F18F74AA02
GO
Isoform 3 (identifier: Q8N7R7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Show »
Length:289
Mass (Da):33,452
Checksum:iE994C632BFE75CDC
GO

Sequence cautioni

The sequence AAH67253 differs from that shown. Reason: Frameshift at position 47.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0291331 – 70Missing in isoform 3. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_029134111 – 173VSPGQ…SHPLT → CDLSNILPHKEQ in isoform 2. 1 PublicationAdd BLAST63

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK097751 mRNA Translation: BAC05160.1
AC096772 Genomic DNA Translation: AAY24056.1
CH471063 Genomic DNA Translation: EAW70420.1
BC067253 mRNA Translation: AAH67253.1 Frameshift.
CCDSiCCDS2377.1 [Q8N7R7-3]
CCDS46503.1 [Q8N7R7-2]
CCDS82564.1 [Q8N7R7-1]
RefSeqiNP_001135772.1, NM_001142300.1 [Q8N7R7-2]
NP_001317147.1, NM_001330218.1 [Q8N7R7-1]
NP_689736.1, NM_152523.2 [Q8N7R7-3]
UniGeneiHs.471234
Hs.597952

Genome annotation databases

EnsembliENST00000295414; ENSP00000295414; ENSG00000163249 [Q8N7R7-1]
ENST00000339882; ENSP00000342344; ENSG00000163249 [Q8N7R7-2]
ENST00000392209; ENSP00000376045; ENSG00000163249 [Q8N7R7-3]
GeneIDi151195
KEGGihsa:151195
UCSCiuc002vch.4 human [Q8N7R7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCCYL1_HUMAN
AccessioniPrimary (citable) accession number: Q8N7R7
Secondary accession number(s): Q6NX60
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: April 25, 2018
This is version 131 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome