Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8N7R7

- CCYL1_HUMAN

UniProt

Q8N7R7 - CCYL1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Cyclin-Y-like protein 1

Gene

CCNYL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Functioni

GO - Biological processi

  1. regulation of cyclin-dependent protein serine/threonine kinase activity Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Cyclin

Enzyme and pathway databases

SignaLinkiQ8N7R7.

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-Y-like protein 1
Gene namesi
Name:CCNYL1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:26868. CCNYL1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162382009.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 359359Cyclin-Y-like protein 1PRO_0000309321Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei105 – 1051Phosphoserine1 Publication
Modified residuei112 – 1121Phosphoserine2 Publications
Modified residuei344 – 3441Phosphoserine4 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8N7R7.
PaxDbiQ8N7R7.
PRIDEiQ8N7R7.

PTM databases

PhosphoSiteiQ8N7R7.

Expressioni

Gene expression databases

BgeeiQ8N7R7.
CleanExiHS_CCNYL1.
ExpressionAtlasiQ8N7R7. baseline and differential.
GenevestigatoriQ8N7R7.

Organism-specific databases

HPAiHPA046825.

Interactioni

Protein-protein interaction databases

BioGridi127353. 7 interactions.
STRINGi9606.ENSP00000342344.

Structurei

3D structure databases

ProteinModelPortaliQ8N7R7.
SMRiQ8N7R7. Positions 179-296.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini145 – 267123Cyclin N-terminalAdd
BLAST

Sequence similaritiesi

Belongs to the cyclin family. Cyclin Y subfamily.Curated
Contains 1 cyclin N-terminal domain.Curated

Phylogenomic databases

eggNOGiNOG303674.
GeneTreeiENSGT00390000006626.
HOGENOMiHOG000021397.
HOVERGENiHBG058985.
InParanoidiQ8N7R7.
OMAiTREEVPD.
OrthoDBiEOG7DC24W.
PhylomeDBiQ8N7R7.
TreeFamiTF314464.

Family and domain databases

Gene3Di1.10.472.10. 1 hit.
InterProiIPR013763. Cyclin-like.
IPR006671. Cyclin_N.
IPR012399. Cyclin_Y.
[Graphical view]
PfamiPF00134. Cyclin_N. 1 hit.
[Graphical view]
PIRSFiPIRSF028934. Cyclin_CG14939. 1 hit.
SMARTiSM00385. CYCLIN. 1 hit.
[Graphical view]
SUPFAMiSSF47954. SSF47954. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8N7R7-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNTLTCCVS PNASPKLGRR AGSAELYCAS DIYEAVSGDA VAVAPAVVEP
60 70 80 90 100
AELDFGEGEG HHLQHISDRE MPEDLALESN PSDHPRASTI FLSKSQTDVR
110 120 130 140 150
EKRKSNHLNH VSPGQLTKKY SSCSTIFLDD STVSQPNLRT TVKCVTLAIY
160 170 180 190 200
YHIKNRDANR SLDIFDERSH PLTREKVPEE YFKHDPEHKF IYRFVRTLFS
210 220 230 240 250
AAQLTAECAI VTLVYLERLL TYAEIDICPT NWKRIVLGAI LLASKVWDDQ
260 270 280 290 300
AVWNVDYCQI LKDITVEDMN EMERHFLELL QFNINVPASV YAKYYFDLRS
310 320 330 340 350
LADDNNLNFL FAPLSKERAQ NLEAISRLCE DKDLCRAAMR RSFSADNFIG

IQRSKAILS
Length:359
Mass (Da):40,705
Last modified:November 13, 2007 - v2
Checksum:i76381F33FE5C890C
GO
Isoform 2 (identifier: Q8N7R7-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     111-173: VSPGQLTKKYSSCSTIFLDDSTVSQPNLRTTVKCVTLAIYYHIKNRDANRSLDIFDERSHPLT → CDLSNILPHKEQ

Show »
Length:308
Mass (Da):34,956
Checksum:i2A39C7F18F74AA02
GO
Isoform 3 (identifier: Q8N7R7-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.

Show »
Length:289
Mass (Da):33,452
Checksum:iE994C632BFE75CDC
GO

Sequence cautioni

The sequence AAH67253.1 differs from that shown. Reason: Frameshift at position 47.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7070Missing in isoform 3. 1 PublicationVSP_029133Add
BLAST
Alternative sequencei111 – 17363VSPGQ…SHPLT → CDLSNILPHKEQ in isoform 2. 1 PublicationVSP_029134Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK097751 mRNA. Translation: BAC05160.1.
AC096772 Genomic DNA. Translation: AAY24056.1.
CH471063 Genomic DNA. Translation: EAW70420.1.
BC067253 mRNA. Translation: AAH67253.1. Frameshift.
CCDSiCCDS2377.1. [Q8N7R7-3]
CCDS46503.1. [Q8N7R7-2]
RefSeqiNP_001135772.1. NM_001142300.1. [Q8N7R7-2]
NP_689736.1. NM_152523.2. [Q8N7R7-3]
XP_005246400.1. XM_005246343.1. [Q8N7R7-1]
UniGeneiHs.471234.
Hs.597952.

Genome annotation databases

EnsembliENST00000295414; ENSP00000295414; ENSG00000163249. [Q8N7R7-1]
ENST00000339882; ENSP00000342344; ENSG00000163249. [Q8N7R7-2]
ENST00000392209; ENSP00000376045; ENSG00000163249. [Q8N7R7-3]
GeneIDi151195.
KEGGihsa:151195.
UCSCiuc002vch.3. human. [Q8N7R7-1]
uc002vci.3. human. [Q8N7R7-2]

Polymorphism databases

DMDMi160380580.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK097751 mRNA. Translation: BAC05160.1 .
AC096772 Genomic DNA. Translation: AAY24056.1 .
CH471063 Genomic DNA. Translation: EAW70420.1 .
BC067253 mRNA. Translation: AAH67253.1 . Frameshift.
CCDSi CCDS2377.1. [Q8N7R7-3 ]
CCDS46503.1. [Q8N7R7-2 ]
RefSeqi NP_001135772.1. NM_001142300.1. [Q8N7R7-2 ]
NP_689736.1. NM_152523.2. [Q8N7R7-3 ]
XP_005246400.1. XM_005246343.1. [Q8N7R7-1 ]
UniGenei Hs.471234.
Hs.597952.

3D structure databases

ProteinModelPortali Q8N7R7.
SMRi Q8N7R7. Positions 179-296.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127353. 7 interactions.
STRINGi 9606.ENSP00000342344.

PTM databases

PhosphoSitei Q8N7R7.

Polymorphism databases

DMDMi 160380580.

Proteomic databases

MaxQBi Q8N7R7.
PaxDbi Q8N7R7.
PRIDEi Q8N7R7.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000295414 ; ENSP00000295414 ; ENSG00000163249 . [Q8N7R7-1 ]
ENST00000339882 ; ENSP00000342344 ; ENSG00000163249 . [Q8N7R7-2 ]
ENST00000392209 ; ENSP00000376045 ; ENSG00000163249 . [Q8N7R7-3 ]
GeneIDi 151195.
KEGGi hsa:151195.
UCSCi uc002vch.3. human. [Q8N7R7-1 ]
uc002vci.3. human. [Q8N7R7-2 ]

Organism-specific databases

CTDi 151195.
GeneCardsi GC02P208576.
HGNCi HGNC:26868. CCNYL1.
HPAi HPA046825.
neXtProti NX_Q8N7R7.
PharmGKBi PA162382009.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG303674.
GeneTreei ENSGT00390000006626.
HOGENOMi HOG000021397.
HOVERGENi HBG058985.
InParanoidi Q8N7R7.
OMAi TREEVPD.
OrthoDBi EOG7DC24W.
PhylomeDBi Q8N7R7.
TreeFami TF314464.

Enzyme and pathway databases

SignaLinki Q8N7R7.

Miscellaneous databases

GenomeRNAii 151195.
NextBioi 86620.
PROi Q8N7R7.

Gene expression databases

Bgeei Q8N7R7.
CleanExi HS_CCNYL1.
ExpressionAtlasi Q8N7R7. baseline and differential.
Genevestigatori Q8N7R7.

Family and domain databases

Gene3Di 1.10.472.10. 1 hit.
InterProi IPR013763. Cyclin-like.
IPR006671. Cyclin_N.
IPR012399. Cyclin_Y.
[Graphical view ]
Pfami PF00134. Cyclin_N. 1 hit.
[Graphical view ]
PIRSFi PIRSF028934. Cyclin_CG14939. 1 hit.
SMARTi SM00385. CYCLIN. 1 hit.
[Graphical view ]
SUPFAMi SSF47954. SSF47954. 1 hit.
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Uterus.
  5. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-112 AND SER-344, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-105; SER-112 AND SER-344, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiCCYL1_HUMAN
AccessioniPrimary (citable) accession number: Q8N7R7
Secondary accession number(s): Q6NX60
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: October 29, 2014
This is version 98 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3