Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8N7R7

- CCYL1_HUMAN

UniProt

Q8N7R7 - CCYL1_HUMAN

Protein

Cyclin-Y-like protein 1

Gene

CCNYL1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 97 (01 Oct 2014)
      Sequence version 2 (13 Nov 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Biological processi

    1. regulation of cyclin-dependent protein serine/threonine kinase activity Source: InterPro

    Keywords - Molecular functioni

    Cyclin

    Enzyme and pathway databases

    SignaLinkiQ8N7R7.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Cyclin-Y-like protein 1
    Gene namesi
    Name:CCNYL1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:26868. CCNYL1.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162382009.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 359359Cyclin-Y-like protein 1PRO_0000309321Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei105 – 1051Phosphoserine1 Publication
    Modified residuei112 – 1121Phosphoserine2 Publications
    Modified residuei344 – 3441Phosphoserine4 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8N7R7.
    PaxDbiQ8N7R7.
    PRIDEiQ8N7R7.

    PTM databases

    PhosphoSiteiQ8N7R7.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8N7R7.
    BgeeiQ8N7R7.
    CleanExiHS_CCNYL1.
    GenevestigatoriQ8N7R7.

    Organism-specific databases

    HPAiHPA046825.

    Interactioni

    Protein-protein interaction databases

    BioGridi127353. 1 interaction.
    STRINGi9606.ENSP00000342344.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8N7R7.
    SMRiQ8N7R7. Positions 179-296.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini145 – 267123Cyclin N-terminalAdd
    BLAST

    Sequence similaritiesi

    Belongs to the cyclin family. Cyclin Y subfamily.Curated
    Contains 1 cyclin N-terminal domain.Curated

    Phylogenomic databases

    eggNOGiNOG303674.
    HOGENOMiHOG000021397.
    HOVERGENiHBG058985.
    InParanoidiQ8N7R7.
    OMAiTREEVPD.
    OrthoDBiEOG7DC24W.
    PhylomeDBiQ8N7R7.
    TreeFamiTF314464.

    Family and domain databases

    Gene3Di1.10.472.10. 1 hit.
    InterProiIPR013763. Cyclin-like.
    IPR006671. Cyclin_N.
    IPR012399. Cyclin_Y.
    [Graphical view]
    PfamiPF00134. Cyclin_N. 1 hit.
    [Graphical view]
    PIRSFiPIRSF028934. Cyclin_CG14939. 1 hit.
    SMARTiSM00385. CYCLIN. 1 hit.
    [Graphical view]
    SUPFAMiSSF47954. SSF47954. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8N7R7-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGNTLTCCVS PNASPKLGRR AGSAELYCAS DIYEAVSGDA VAVAPAVVEP    50
    AELDFGEGEG HHLQHISDRE MPEDLALESN PSDHPRASTI FLSKSQTDVR 100
    EKRKSNHLNH VSPGQLTKKY SSCSTIFLDD STVSQPNLRT TVKCVTLAIY 150
    YHIKNRDANR SLDIFDERSH PLTREKVPEE YFKHDPEHKF IYRFVRTLFS 200
    AAQLTAECAI VTLVYLERLL TYAEIDICPT NWKRIVLGAI LLASKVWDDQ 250
    AVWNVDYCQI LKDITVEDMN EMERHFLELL QFNINVPASV YAKYYFDLRS 300
    LADDNNLNFL FAPLSKERAQ NLEAISRLCE DKDLCRAAMR RSFSADNFIG 350
    IQRSKAILS 359
    Length:359
    Mass (Da):40,705
    Last modified:November 13, 2007 - v2
    Checksum:i76381F33FE5C890C
    GO
    Isoform 2 (identifier: Q8N7R7-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         111-173: VSPGQLTKKYSSCSTIFLDDSTVSQPNLRTTVKCVTLAIYYHIKNRDANRSLDIFDERSHPLT → CDLSNILPHKEQ

    Show »
    Length:308
    Mass (Da):34,956
    Checksum:i2A39C7F18F74AA02
    GO
    Isoform 3 (identifier: Q8N7R7-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-70: Missing.

    Show »
    Length:289
    Mass (Da):33,452
    Checksum:iE994C632BFE75CDC
    GO

    Sequence cautioni

    The sequence AAH67253.1 differs from that shown. Reason: Frameshift at position 47.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7070Missing in isoform 3. 1 PublicationVSP_029133Add
    BLAST
    Alternative sequencei111 – 17363VSPGQ…SHPLT → CDLSNILPHKEQ in isoform 2. 1 PublicationVSP_029134Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK097751 mRNA. Translation: BAC05160.1.
    AC096772 Genomic DNA. Translation: AAY24056.1.
    CH471063 Genomic DNA. Translation: EAW70420.1.
    BC067253 mRNA. Translation: AAH67253.1. Frameshift.
    CCDSiCCDS2377.1. [Q8N7R7-3]
    CCDS46503.1. [Q8N7R7-2]
    RefSeqiNP_001135772.1. NM_001142300.1. [Q8N7R7-2]
    NP_689736.1. NM_152523.2. [Q8N7R7-3]
    XP_005246400.1. XM_005246343.1. [Q8N7R7-1]
    UniGeneiHs.471234.
    Hs.597952.

    Genome annotation databases

    EnsembliENST00000295414; ENSP00000295414; ENSG00000163249. [Q8N7R7-1]
    ENST00000339882; ENSP00000342344; ENSG00000163249. [Q8N7R7-2]
    ENST00000392209; ENSP00000376045; ENSG00000163249. [Q8N7R7-3]
    GeneIDi151195.
    KEGGihsa:151195.
    UCSCiuc002vch.3. human. [Q8N7R7-1]
    uc002vci.3. human. [Q8N7R7-2]

    Polymorphism databases

    DMDMi160380580.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK097751 mRNA. Translation: BAC05160.1 .
    AC096772 Genomic DNA. Translation: AAY24056.1 .
    CH471063 Genomic DNA. Translation: EAW70420.1 .
    BC067253 mRNA. Translation: AAH67253.1 . Frameshift.
    CCDSi CCDS2377.1. [Q8N7R7-3 ]
    CCDS46503.1. [Q8N7R7-2 ]
    RefSeqi NP_001135772.1. NM_001142300.1. [Q8N7R7-2 ]
    NP_689736.1. NM_152523.2. [Q8N7R7-3 ]
    XP_005246400.1. XM_005246343.1. [Q8N7R7-1 ]
    UniGenei Hs.471234.
    Hs.597952.

    3D structure databases

    ProteinModelPortali Q8N7R7.
    SMRi Q8N7R7. Positions 179-296.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127353. 1 interaction.
    STRINGi 9606.ENSP00000342344.

    PTM databases

    PhosphoSitei Q8N7R7.

    Polymorphism databases

    DMDMi 160380580.

    Proteomic databases

    MaxQBi Q8N7R7.
    PaxDbi Q8N7R7.
    PRIDEi Q8N7R7.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000295414 ; ENSP00000295414 ; ENSG00000163249 . [Q8N7R7-1 ]
    ENST00000339882 ; ENSP00000342344 ; ENSG00000163249 . [Q8N7R7-2 ]
    ENST00000392209 ; ENSP00000376045 ; ENSG00000163249 . [Q8N7R7-3 ]
    GeneIDi 151195.
    KEGGi hsa:151195.
    UCSCi uc002vch.3. human. [Q8N7R7-1 ]
    uc002vci.3. human. [Q8N7R7-2 ]

    Organism-specific databases

    CTDi 151195.
    GeneCardsi GC02P208576.
    HGNCi HGNC:26868. CCNYL1.
    HPAi HPA046825.
    neXtProti NX_Q8N7R7.
    PharmGKBi PA162382009.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG303674.
    HOGENOMi HOG000021397.
    HOVERGENi HBG058985.
    InParanoidi Q8N7R7.
    OMAi TREEVPD.
    OrthoDBi EOG7DC24W.
    PhylomeDBi Q8N7R7.
    TreeFami TF314464.

    Enzyme and pathway databases

    SignaLinki Q8N7R7.

    Miscellaneous databases

    GenomeRNAii 151195.
    NextBioi 86620.
    PROi Q8N7R7.

    Gene expression databases

    ArrayExpressi Q8N7R7.
    Bgeei Q8N7R7.
    CleanExi HS_CCNYL1.
    Genevestigatori Q8N7R7.

    Family and domain databases

    Gene3Di 1.10.472.10. 1 hit.
    InterProi IPR013763. Cyclin-like.
    IPR006671. Cyclin_N.
    IPR012399. Cyclin_Y.
    [Graphical view ]
    Pfami PF00134. Cyclin_N. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF028934. Cyclin_CG14939. 1 hit.
    SMARTi SM00385. CYCLIN. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47954. SSF47954. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Testis.
    2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Uterus.
    5. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-344, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-112 AND SER-344, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-105; SER-112 AND SER-344, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiCCYL1_HUMAN
    AccessioniPrimary (citable) accession number: Q8N7R7
    Secondary accession number(s): Q6NX60
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 13, 2007
    Last sequence update: November 13, 2007
    Last modified: October 1, 2014
    This is version 97 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3