Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DDB1- and CUL4-associated factor 8

Gene

Dcaf8

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.By similarity

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
DDB1- and CUL4-associated factor 8
Alternative name(s):
WD repeat-containing protein 42A
Gene namesi
Name:Dcaf8
Synonyms:D1Ucla4, H326, Wdr42a
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 1

Organism-specific databases

MGIiMGI:91860. Dcaf8.

Subcellular locationi

  • Nucleus By similarity
  • Cytoplasm By similarity

  • Note: It shuttles between the nucleus and the cytoplasm. Nuclear import is mediated by KPNA1 and KPNB1 under the regulation of nuclear GTPase RAN. Nuclear export to the cytoplasm is XPO1 dependent.By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 591591DDB1- and CUL4-associated factor 8PRO_0000296958Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei22 – 221PhosphoserineCombined sources
Modified residuei23 – 231PhosphoserineCombined sources
Modified residuei100 – 1001PhosphoserineCombined sources
Modified residuei123 – 1231PhosphoserineCombined sources
Modified residuei124 – 1241PhosphoserineCombined sources
Modified residuei198 – 1981Omega-N-methylarginine; by PRMT1By similarity

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiQ8N7N5.
MaxQBiQ8N7N5.
PaxDbiQ8N7N5.
PRIDEiQ8N7N5.

PTM databases

iPTMnetiQ8N7N5.
PhosphoSiteiQ8N7N5.

Expressioni

Tissue specificityi

Expressed in the brain.1 Publication

Developmental stagei

Expressed in the brain at E8.5 E9.5 and E10.5.1 Publication

Gene expression databases

BgeeiQ8N7N5.
CleanExiMM_WDR42A.
ExpressionAtlasiQ8N7N5. baseline and differential.
GenevisibleiQ8N7N5. MM.

Interactioni

Subunit structurei

Interacts with DDB1, CUL4A and CUL4B. Interacts with KPNA1, KPNB1 and XPO1.By similarity

Protein-protein interaction databases

IntActiQ8N7N5. 1 interaction.
MINTiMINT-4118058.
STRINGi10090.ENSMUSP00000073778.

Structurei

3D structure databases

ProteinModelPortaliQ8N7N5.
SMRiQ8N7N5. Positions 177-499.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati185 – 22440WD 1Add
BLAST
Repeati228 – 26942WD 2Add
BLAST
Repeati275 – 31541WD 3Add
BLAST
Repeati323 – 36341WD 4Add
BLAST
Repeati379 – 41840WD 5Add
BLAST
Repeati426 – 46641WD 6Add
BLAST
Repeati470 – 50940WD 7Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi40 – 5112Nuclear export signalBy similarityAdd
BLAST

Sequence similaritiesi

Belongs to the WD repeat DCAF8 family.Curated
Contains 7 WD repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG1334. Eukaryota.
ENOG410XQZP. LUCA.
GeneTreeiENSGT00530000062951.
HOGENOMiHOG000243561.
HOVERGENiHBG053807.
InParanoidiQ8N7N5.
KOiK11804.
OMAiDENQVHD.
OrthoDBiEOG7GBFX0.
PhylomeDBiQ8N7N5.
TreeFamiTF326071.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 3 hits.
[Graphical view]
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N7N5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSNKRPNTTD GRTDLANGSL SSSPEEMSGA EEGRETSSGI EVEASDLSLS
60 70 80 90 100
LTGDDGGPNR TSTESRGTDT ESSGEEKDSD SMEDTGHYSI NDESRGHGHS
110 120 130 140 150
DEEDEEQPRH RGQRKRASRD QDSSDDERAL EDWVSSETTA LPRPRWQALP
160 170 180 190 200
ALRERELGSS ARFVYEACGA RVFVQRFRLQ HGLEGHTGCV NTLHFNQRGT
210 220 230 240 250
WLASGSDDLK VVVWDWVRRQ PVLDFESGHK SNVFQAKFLP NSGDSTLAMC
260 270 280 290 300
ARDGQVRVAE LSATQCCKNT KRVAQHKGAS HKLALEPDSP CTFLSAGEDA
310 320 330 340 350
VVFTIDLRQD RPASKLVVTK EKEKKVGLYT IYVNPANTHQ FAVGGRDQYV
360 370 380 390 400
RIYDQRKIDE NENNGVLKKF CPHHLVNSES KANITCLVYS HDGTELLASY
410 420 430 440 450
NDEDIYLFNS SHSDGAQYIK RYKGHRNNAT VKGVNFYGPK SEFVVSGSDC
460 470 480 490 500
GHIFLWEKSS CQIIQFMEGD KGGVVNCLEP HPHLPVLATS GLDHDVKIWA
510 520 530 540 550
PTAEASTELT GLKEVIKKNK RERDEDSLHH TDLFDSHMLW FLMHHLRQRR
560 570 580 590
HHRRWREPGV GATDADSDES PSSSDTSDEE EGPDRVQCMP S
Length:591
Mass (Da):66,031
Last modified:October 1, 2002 - v1
Checksum:i2FFC175E1E2D1F4A
GO
Isoform 2 (identifier: Q8N7N5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     376-411: VNSESKANITCLVYSHDGTELLASYNDEDIYLFNSS → SSWPVTMMKTFTFSTLLTVMGPSILRDTKAIEIMLQ
     412-591: Missing.

Note: No experimental confirmation available.
Show »
Length:411
Mass (Da):45,725
Checksum:i5B685C0D492EAAC9
GO

Sequence cautioni

The sequence AAH23704.1 differs from that shown. Reason: Erroneous initiation. Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei376 – 41136VNSES…LFNSS → SSWPVTMMKTFTFSTLLTVM GPSILRDTKAIEIMLQ in isoform 2. 1 PublicationVSP_027266Add
BLAST
Alternative sequencei412 – 591180Missing in isoform 2. 1 PublicationVSP_027267Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098114 mRNA. Translation: BAC05237.1.
AK146825 mRNA. Translation: BAE27462.1.
BC023704 mRNA. Translation: AAH23704.1. Different initiation.
BC023804 mRNA. Translation: AAH23804.1.
CCDSiCCDS15509.1. [Q8N7N5-1]
RefSeqiNP_705783.1. NM_153555.2. [Q8N7N5-1]
XP_006497128.1. XM_006497065.2. [Q8N7N5-1]
XP_011237191.1. XM_011238889.1. [Q8N7N5-1]
UniGeneiMm.159915.

Genome annotation databases

EnsembliENSMUST00000074144; ENSMUSP00000073778; ENSMUSG00000026554. [Q8N7N5-1]
ENSMUST00000191689; ENSMUSP00000141731; ENSMUSG00000026554. [Q8N7N5-1]
ENSMUST00000192704; ENSMUSP00000141732; ENSMUSG00000026554. [Q8N7N5-1]
ENSMUST00000193638; ENSMUSP00000141836; ENSMUSG00000026554. [Q8N7N5-2]
GeneIDi98193.
KEGGimmu:98193.
UCSCiuc007dpr.2. mouse. [Q8N7N5-2]
uc007dps.2. mouse. [Q8N7N5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098114 mRNA. Translation: BAC05237.1.
AK146825 mRNA. Translation: BAE27462.1.
BC023704 mRNA. Translation: AAH23704.1. Different initiation.
BC023804 mRNA. Translation: AAH23804.1.
CCDSiCCDS15509.1. [Q8N7N5-1]
RefSeqiNP_705783.1. NM_153555.2. [Q8N7N5-1]
XP_006497128.1. XM_006497065.2. [Q8N7N5-1]
XP_011237191.1. XM_011238889.1. [Q8N7N5-1]
UniGeneiMm.159915.

3D structure databases

ProteinModelPortaliQ8N7N5.
SMRiQ8N7N5. Positions 177-499.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ8N7N5. 1 interaction.
MINTiMINT-4118058.
STRINGi10090.ENSMUSP00000073778.

PTM databases

iPTMnetiQ8N7N5.
PhosphoSiteiQ8N7N5.

Proteomic databases

EPDiQ8N7N5.
MaxQBiQ8N7N5.
PaxDbiQ8N7N5.
PRIDEiQ8N7N5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000074144; ENSMUSP00000073778; ENSMUSG00000026554. [Q8N7N5-1]
ENSMUST00000191689; ENSMUSP00000141731; ENSMUSG00000026554. [Q8N7N5-1]
ENSMUST00000192704; ENSMUSP00000141732; ENSMUSG00000026554. [Q8N7N5-1]
ENSMUST00000193638; ENSMUSP00000141836; ENSMUSG00000026554. [Q8N7N5-2]
GeneIDi98193.
KEGGimmu:98193.
UCSCiuc007dpr.2. mouse. [Q8N7N5-2]
uc007dps.2. mouse. [Q8N7N5-1]

Organism-specific databases

CTDi50717.
MGIiMGI:91860. Dcaf8.

Phylogenomic databases

eggNOGiKOG1334. Eukaryota.
ENOG410XQZP. LUCA.
GeneTreeiENSGT00530000062951.
HOGENOMiHOG000243561.
HOVERGENiHBG053807.
InParanoidiQ8N7N5.
KOiK11804.
OMAiDENQVHD.
OrthoDBiEOG7GBFX0.
PhylomeDBiQ8N7N5.
TreeFamiTF326071.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

ChiTaRSiDcaf8. mouse.
NextBioi353348.
PROiQ8N7N5.
SOURCEiSearch...

Gene expression databases

BgeeiQ8N7N5.
CleanExiMM_WDR42A.
ExpressionAtlasiQ8N7N5. baseline and differential.
GenevisibleiQ8N7N5. MM.

Family and domain databases

Gene3Di2.130.10.10. 2 hits.
InterProiIPR015943. WD40/YVTN_repeat-like_dom.
IPR001680. WD40_repeat.
IPR017986. WD40_repeat_dom.
[Graphical view]
PfamiPF00400. WD40. 3 hits.
[Graphical view]
SMARTiSM00320. WD40. 7 hits.
[Graphical view]
SUPFAMiSSF50978. SSF50978. 1 hit.
PROSITEiPS50082. WD_REPEATS_2. 1 hit.
PS50294. WD_REPEATS_REGION. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "The transcriptional landscape of the mammalian genome."
    Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J.
    , Wilming L.G., Aidinis V., Allen J.E., Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L., Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M., Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R., Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G., di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G., Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M., Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E., Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N., Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T., Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H., Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K., Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J., Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L., Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K., Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P., Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O., Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G., Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M., Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C., Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y., Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B., Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K., Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A., Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K., Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C., Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J., Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y., Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T., Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N., Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N., Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S., Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J., Hayashizaki Y.
    Science 309:1559-1563(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Strain: C57BL/6J.
    Tissue: Liver.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Strain: FVB/N.
    Tissue: Mammary tumor.
  4. "Comparative physical and transcript maps of approximately 1 Mb around loop-tail, a gene for severe neural tube defects on distal mouse chromosome 1 and human chromosome 1q22-q23."
    Doudney K., Murdoch J.N., Paternotte C., Bentley L., Gregory S., Copp A.J., Stanier P.
    Genomics 72:180-192(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, DEVELOPMENTAL STAGE.
  5. "Large scale localization of protein phosphorylation by use of electron capture dissociation mass spectrometry."
    Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.
    Mol. Cell. Proteomics 8:904-912(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic fibroblast.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-22; SER-23; SER-100; SER-123 AND SER-124, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas, Spleen and Testis.

Entry informationi

Entry nameiDCAF8_MOUSE
AccessioniPrimary (citable) accession number: Q8N7N5
Secondary accession number(s): Q8CII7, Q8CIK6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: October 1, 2002
Last modified: March 16, 2016
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Miscellaneous

The homozygous loop-tail (Lp) mouse has a severe neural tube closure defect, analogous to the craniorachischisis phenotype seen in humans. This gene has been mapped to The Lp critical region.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.