Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable E3 ubiquitin-protein ligase TRIML2

Gene

TRIML2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Probable E3 ubiquitin-protein ligase TRIML2 (EC:6.3.2.-)
Alternative name(s):
SPRY domain-containing protein 6
Tripartite motif family-like protein 2
Gene namesi
Name:TRIML2
Synonyms:SPRYD6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:26378. TRIML2.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162407031.

Polymorphism and mutation databases

BioMutaiTRIML2.
DMDMi74714998.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 387387Probable E3 ubiquitin-protein ligase TRIML2PRO_0000317435Add
BLAST

Proteomic databases

EPDiQ8N7C3.
MaxQBiQ8N7C3.
PaxDbiQ8N7C3.
PeptideAtlasiQ8N7C3.
PRIDEiQ8N7C3.

Expressioni

Gene expression databases

BgeeiQ8N7C3.
CleanExiHS_TRIML2.
ExpressionAtlasiQ8N7C3. baseline and differential.
GenevisibleiQ8N7C3. HS.

Organism-specific databases

HPAiHPA043838.

Interactioni

Protein-protein interaction databases

BioGridi128500. 14 interactions.
IntActiQ8N7C3. 1 interaction.
STRINGi9606.ENSP00000422581.

Structurei

3D structure databases

ProteinModelPortaliQ8N7C3.
SMRiQ8N7C3. Positions 39-374.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini181 – 379199B30.2/SPRYPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili5 – 150146Sequence analysisAdd
BLAST

Sequence similaritiesi

Contains 1 B30.2/SPRY domain.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG2177. Eukaryota.
ENOG41112S7. LUCA.
HOVERGENiHBG106592.
InParanoidiQ8N7C3.
KOiK12039.
OrthoDBiEOG7HF1JH.
PhylomeDBiQ8N7C3.
TreeFamiTF338674.

Family and domain databases

InterProiIPR001870. B30.2/SPRY.
IPR003879. Butyrophylin.
IPR013320. ConA-like_dom.
IPR006574. PRY.
IPR003877. SPRY_dom.
[Graphical view]
PfamiPF13765. PRY. 1 hit.
PF00622. SPRY. 1 hit.
[Graphical view]
PRINTSiPR01407. BUTYPHLNCDUF.
SMARTiSM00589. PRY. 1 hit.
SM00449. SPRY. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS50188. B302_SPRY. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q8N7C3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVCGIQEAAE NYRKLFQEIL NTSREKLEAA KSILTDEQER MAMIQEEEQN
60 70 80 90 100
FKKMIESEYS MRLRLLNEEC EQNLQRQQEC ISDLNLRETL LNQAIKLATE
110 120 130 140 150
LEEMFQEMLQ RLGRVGRENM EKLKESEARA SEQVRSLLKL IVELEKKCGE
160 170 180 190 200
GTLALLKNAK YSLERSKSLL LEHLEPAHIT DLSLCHIRGL SSMFRVLQRH
210 220 230 240 250
LTLDPETAHP CLALSEDLRT MRLRHGQQDG AGNPERLDFS AMVLAAESFT
260 270 280 290 300
SGRHYWEVDV EKATRWQVGI YHGSADAKGS TARASGEKVL LTGSVMGTEW
310 320 330 340 350
TLWVFPPLKR LFLEKKLDTV GVFLDCEHGQ ISFYNVTEMS LIYNFSHCAF
360 370 380
QGALRPVFSL CIPNGDTSPD SLTILQHGPS CDATVSP
Length:387
Mass (Da):43,983
Last modified:October 1, 2002 - v1
Checksum:i57F0DA0B87F93032
GO
Isoform 2 (identifier: Q8N7C3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSKRLSPQLQHNITEDAYCETHLEPTRLFCDVDQITLCSKCFQSQEHKHHM
     158-171: NAKYSLERSKSLLL → VRCWEKENKIHSSI
     172-387: Missing.

Note: No experimental confirmation available.
Show »
Length:221
Mass (Da):26,050
Checksum:iA5CF937B378CE162
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MSKRLSPQLQHNITEDAYCE THLEPTRLFCDVDQITLCSK CFQSQEHKHHM in isoform 2. 1 PublicationVSP_055446
Alternative sequencei158 – 17114NAKYS…KSLLL → VRCWEKENKIHSSI in isoform 2. 1 PublicationVSP_055447Add
BLAST
Alternative sequencei172 – 387216Missing in isoform 2. 1 PublicationVSP_055448Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098667 mRNA. Translation: BAC05372.1.
AK300428 mRNA. Translation: BAH13282.1.
AC108073 Genomic DNA. No translation available.
BC111959 mRNA. Translation: AAI11960.1.
BC111961 mRNA. Translation: AAI11962.1.
RefSeqiNP_001290348.1. NM_001303419.1.
NP_775824.2. NM_173553.2.
UniGeneiHs.276429.

Genome annotation databases

EnsembliENST00000512729; ENSP00000422581; ENSG00000179046.
GeneIDi205860.
KEGGihsa:205860.
UCSCiuc003izl.3. human. [Q8N7C3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK098667 mRNA. Translation: BAC05372.1.
AK300428 mRNA. Translation: BAH13282.1.
AC108073 Genomic DNA. No translation available.
BC111959 mRNA. Translation: AAI11960.1.
BC111961 mRNA. Translation: AAI11962.1.
RefSeqiNP_001290348.1. NM_001303419.1.
NP_775824.2. NM_173553.2.
UniGeneiHs.276429.

3D structure databases

ProteinModelPortaliQ8N7C3.
SMRiQ8N7C3. Positions 39-374.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128500. 14 interactions.
IntActiQ8N7C3. 1 interaction.
STRINGi9606.ENSP00000422581.

Polymorphism and mutation databases

BioMutaiTRIML2.
DMDMi74714998.

Proteomic databases

EPDiQ8N7C3.
MaxQBiQ8N7C3.
PaxDbiQ8N7C3.
PeptideAtlasiQ8N7C3.
PRIDEiQ8N7C3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000512729; ENSP00000422581; ENSG00000179046.
GeneIDi205860.
KEGGihsa:205860.
UCSCiuc003izl.3. human. [Q8N7C3-1]

Organism-specific databases

CTDi205860.
GeneCardsiTRIML2.
HGNCiHGNC:26378. TRIML2.
HPAiHPA043838.
neXtProtiNX_Q8N7C3.
PharmGKBiPA162407031.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2177. Eukaryota.
ENOG41112S7. LUCA.
HOVERGENiHBG106592.
InParanoidiQ8N7C3.
KOiK12039.
OrthoDBiEOG7HF1JH.
PhylomeDBiQ8N7C3.
TreeFamiTF338674.

Enzyme and pathway databases

UniPathwayiUPA00143.

Miscellaneous databases

GenomeRNAii205860.
PROiQ8N7C3.

Gene expression databases

BgeeiQ8N7C3.
CleanExiHS_TRIML2.
ExpressionAtlasiQ8N7C3. baseline and differential.
GenevisibleiQ8N7C3. HS.

Family and domain databases

InterProiIPR001870. B30.2/SPRY.
IPR003879. Butyrophylin.
IPR013320. ConA-like_dom.
IPR006574. PRY.
IPR003877. SPRY_dom.
[Graphical view]
PfamiPF13765. PRY. 1 hit.
PF00622. SPRY. 1 hit.
[Graphical view]
PRINTSiPR01407. BUTYPHLNCDUF.
SMARTiSM00589. PRY. 1 hit.
SM00449. SPRY. 1 hit.
[Graphical view]
SUPFAMiSSF49899. SSF49899. 1 hit.
PROSITEiPS50188. B302_SPRY. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Placenta and Testis.
  2. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.

Entry informationi

Entry nameiTRIMM_HUMAN
AccessioniPrimary (citable) accession number: Q8N7C3
Secondary accession number(s): B7Z6J6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: October 1, 2002
Last modified: July 6, 2016
This is version 97 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.