Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q8N720

- ZN655_HUMAN

UniProt

Q8N720 - ZN655_HUMAN

Protein

Zinc finger protein 655

Gene

ZNF655

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 110 (01 Oct 2014)
      Sequence version 3 (17 Oct 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in transcriptional regulation.

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri212 – 23423C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri240 – 26223C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri303 – 32523C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri330 – 35324C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri380 – 40223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri408 – 43023C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW
    3. protein binding Source: IntAct
    4. sequence-specific DNA binding transcription factor activity Source: RefGenome

    GO - Biological processi

    1. negative regulation of G1/S transition of mitotic cell cycle Source: UniProtKB
    2. regulation of transcription, DNA-templated Source: RefGenome
    3. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_12627. Generic Transcription Pathway.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein 655
    Alternative name(s):
    Vav-interacting Krueppel-like protein
    Gene namesi
    Name:ZNF655
    Synonyms:VIK
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 7

    Organism-specific databases

    HGNCiHGNC:30899. ZNF655.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. nucleolus Source: UniProtKB
    3. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134883537.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 491491Zinc finger protein 655PRO_0000047700Add
    BLAST

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ8N720.
    PaxDbiQ8N720.
    PeptideAtlasiQ8N720.
    PRIDEiQ8N720.

    PTM databases

    PhosphoSiteiQ8N720.

    Expressioni

    Gene expression databases

    ArrayExpressiQ8N720.
    BgeeiQ8N720.
    CleanExiHS_ZNF655.
    GenevestigatoriQ8N720.

    Organism-specific databases

    HPAiHPA029534.
    HPA050750.

    Interactioni

    Subunit structurei

    Interacts with VAV1 and CDK4.1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CDK4P118023EBI-625509,EBI-295644
    VAV1P154985EBI-625509,EBI-625518

    Protein-protein interaction databases

    BioGridi122495. 8 interactions.
    DIPiDIP-34108N.
    IntActiQ8N720. 13 interactions.
    MINTiMINT-1211608.
    STRINGi9606.ENSP00000393876.

    Structurei

    3D structure databases

    ProteinModelPortaliQ8N720.
    SMRiQ8N720. Positions 120-489.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Contains 6 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri212 – 23423C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri240 – 26223C2H2-type 2PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri303 – 32523C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri330 – 35324C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri380 – 40223C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri408 – 43023C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOVERGENiHBG018163.
    InParanoidiQ8N720.
    OMAiEASDKSC.
    OrthoDBiEOG79CZ0P.
    PhylomeDBiQ8N720.
    TreeFamiTF344137.

    Family and domain databases

    Gene3Di3.30.160.60. 8 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF00096. zf-C2H2. 1 hit.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 7 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 6 hits.
    PS50157. ZINC_FINGER_C2H2_2. 6 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q8N720-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEEIPAQEAA GSPRVQFQSL ETQSECLSPE PQFVQDTDME QGLTGDGETR    50
    EENKLLIPKQ KISEEVHSYK VRVGRLKHDI TQVPETREVY KSEDRLERLQ 100
    EILRKFLYLE REFRQITISK ETFTSEKNNE CHEPEKSFSL DSTIDADQRV 150
    LRIQNTDDND KYDMSFNQNS ASGKHEHLNL TEDFQSSECK ESLMDLSHLN 200
    KWESIPNTEK SYKCDVCGKI FHQSSALTRH QRIHTREKPY KCKECEKSFS 250
    QSSSLSRHKR IHTREKPYKC EASDKSCEAS DKSCSPSSGI IQHKKIHTRA 300
    KSYKCSSCER VFSRSVHLTQ HQKIHKEMPC KCTVCGSDFC HTSYLLEHQR 350
    VHHEEKAYEY DEYGLAYIKQ QGIHFREKPY TCSECGKDFR LNSHLIQHQR 400
    IHTGEKAHEC NECGKAFSQT SCLIQHHKMH RKEKSYECNE YEGSFSHSSD 450
    LILQQEVLTR QKAFDCDVWE KNSSQRAHLV QHQSIHTKEN S 491
    Length:491
    Mass (Da):57,407
    Last modified:October 17, 2006 - v3
    Checksum:i04FD791D769C3A80
    GO
    Isoform 2 (identifier: Q8N720-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         46-181: DGETREENKL...SGKHEHLNLT → APPVPQVPAL...PCSETPFPRL
         182-491: Missing.

    Note: Contains a phosphoserine at position 60.

    Show »
    Length:181
    Mass (Da):20,005
    Checksum:i5279EA5A29623353
    GO
    Isoform 3 (identifier: Q8N720-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         45-45: G → GGFPISKPDGISQLEQDLQVFDLETKTREVLRDDCS

    Show »
    Length:526
    Mass (Da):61,369
    Checksum:i10FD9EB53A793034
    GO
    Isoform 4 (identifier: Q8N720-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         46-110: DGETREENKL...EILRKFLYLE → GILLRLPTTR...PCSETPFPRL
         111-491: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:110
    Mass (Da):12,037
    Checksum:iF59440491AE80D7B
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti178 – 1781L → S in BAH14395. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti52 – 521E → D.1 Publication
    Corresponds to variant rs17853754 [ dbSNP | Ensembl ].
    VAR_028165

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei45 – 451G → GGFPISKPDGISQLEQDLQV FDLETKTREVLRDDCS in isoform 3. 1 PublicationVSP_041157
    Alternative sequencei46 – 181136DGETR…HLNLT → APPVPQVPALPREGSPGDQA AALLTARYQEFVTFEDVAVH LTREEWGYLDPVQRDLYREV MLENYGNVVSLGILLRLPTT RIHSVNSCPALSHTQASAFS GETLAVLTAGISKRWPKYRL PIDIARPCSETPFPRL in isoform 2. 1 PublicationVSP_036030Add
    BLAST
    Alternative sequencei46 – 11065DGETR…FLYLE → GILLRLPTTRIHSVNSCPAL SHTQASAFSGETLAVLTAGI SKRWPKYRLPIDIARPCSET PFPRL in isoform 4. 1 PublicationVSP_044809Add
    BLAST
    Alternative sequencei111 – 491381Missing in isoform 4. 1 PublicationVSP_044810Add
    BLAST
    Alternative sequencei182 – 491310Missing in isoform 2. 1 PublicationVSP_036031Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY099353 mRNA. Translation: AAM33786.1.
    AK027114 mRNA. No translation available.
    AK304785 mRNA. Translation: BAG65536.1.
    AK314593 mRNA. Translation: BAG37165.1.
    AK316024 mRNA. Translation: BAH14395.1.
    AC005020 Genomic DNA. Translation: AAS02017.1.
    CH236956 Genomic DNA. Translation: EAL23871.1.
    CH471091 Genomic DNA. Translation: EAW76650.1.
    CH236956 Genomic DNA. Translation: EAL23870.1.
    CH471091 Genomic DNA. Translation: EAW76651.1.
    BC000823 mRNA. Translation: AAH00823.1.
    BC004288 mRNA. Translation: AAH04288.1.
    BC007378 mRNA. Translation: AAH07378.1.
    BC011816 mRNA. Translation: AAH11816.1.
    BC024770 mRNA. Translation: AAH24770.1.
    BC037407 mRNA. Translation: AAH37407.1.
    CCDSiCCDS34695.1. [Q8N720-4]
    CCDS47655.1. [Q8N720-3]
    CCDS5669.1. [Q8N720-1]
    CCDS5670.1. [Q8N720-2]
    RefSeqiNP_001009958.1. NM_001009958.1. [Q8N720-4]
    NP_001009960.1. NM_001009960.1. [Q8N720-1]
    NP_001077425.1. NM_001083956.1. [Q8N720-3]
    NP_001078835.1. NM_001085366.1. [Q8N720-4]
    NP_001078836.1. NM_001085367.1. [Q8N720-2]
    NP_001078837.1. NM_001085368.1. [Q8N720-3]
    NP_076966.1. NM_024061.3. [Q8N720-2]
    NP_612503.1. NM_138494.2. [Q8N720-1]
    UniGeneiHs.599798.

    Genome annotation databases

    EnsembliENST00000252713; ENSP00000252713; ENSG00000197343. [Q8N720-1]
    ENST00000320583; ENSP00000322363; ENSG00000197343. [Q8N720-2]
    ENST00000357864; ENSP00000350530; ENSG00000197343. [Q8N720-4]
    ENST00000394163; ENSP00000377718; ENSG00000197343. [Q8N720-1]
    ENST00000424881; ENSP00000393876; ENSG00000197343. [Q8N720-3]
    ENST00000440391; ENSP00000396396; ENSG00000197343. [Q8N720-4]
    ENST00000493277; ENSP00000419135; ENSG00000197343. [Q8N720-3]
    GeneIDi79027.
    KEGGihsa:79027.
    UCSCiuc003urc.3. human. [Q8N720-2]
    uc003urh.3. human. [Q8N720-1]
    uc003uri.3. human.
    uc010lga.3. human. [Q8N720-3]

    Polymorphism databases

    DMDMi116242863.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY099353 mRNA. Translation: AAM33786.1 .
    AK027114 mRNA. No translation available.
    AK304785 mRNA. Translation: BAG65536.1 .
    AK314593 mRNA. Translation: BAG37165.1 .
    AK316024 mRNA. Translation: BAH14395.1 .
    AC005020 Genomic DNA. Translation: AAS02017.1 .
    CH236956 Genomic DNA. Translation: EAL23871.1 .
    CH471091 Genomic DNA. Translation: EAW76650.1 .
    CH236956 Genomic DNA. Translation: EAL23870.1 .
    CH471091 Genomic DNA. Translation: EAW76651.1 .
    BC000823 mRNA. Translation: AAH00823.1 .
    BC004288 mRNA. Translation: AAH04288.1 .
    BC007378 mRNA. Translation: AAH07378.1 .
    BC011816 mRNA. Translation: AAH11816.1 .
    BC024770 mRNA. Translation: AAH24770.1 .
    BC037407 mRNA. Translation: AAH37407.1 .
    CCDSi CCDS34695.1. [Q8N720-4 ]
    CCDS47655.1. [Q8N720-3 ]
    CCDS5669.1. [Q8N720-1 ]
    CCDS5670.1. [Q8N720-2 ]
    RefSeqi NP_001009958.1. NM_001009958.1. [Q8N720-4 ]
    NP_001009960.1. NM_001009960.1. [Q8N720-1 ]
    NP_001077425.1. NM_001083956.1. [Q8N720-3 ]
    NP_001078835.1. NM_001085366.1. [Q8N720-4 ]
    NP_001078836.1. NM_001085367.1. [Q8N720-2 ]
    NP_001078837.1. NM_001085368.1. [Q8N720-3 ]
    NP_076966.1. NM_024061.3. [Q8N720-2 ]
    NP_612503.1. NM_138494.2. [Q8N720-1 ]
    UniGenei Hs.599798.

    3D structure databases

    ProteinModelPortali Q8N720.
    SMRi Q8N720. Positions 120-489.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122495. 8 interactions.
    DIPi DIP-34108N.
    IntActi Q8N720. 13 interactions.
    MINTi MINT-1211608.
    STRINGi 9606.ENSP00000393876.

    PTM databases

    PhosphoSitei Q8N720.

    Polymorphism databases

    DMDMi 116242863.

    Proteomic databases

    MaxQBi Q8N720.
    PaxDbi Q8N720.
    PeptideAtlasi Q8N720.
    PRIDEi Q8N720.

    Protocols and materials databases

    DNASUi 79027.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000252713 ; ENSP00000252713 ; ENSG00000197343 . [Q8N720-1 ]
    ENST00000320583 ; ENSP00000322363 ; ENSG00000197343 . [Q8N720-2 ]
    ENST00000357864 ; ENSP00000350530 ; ENSG00000197343 . [Q8N720-4 ]
    ENST00000394163 ; ENSP00000377718 ; ENSG00000197343 . [Q8N720-1 ]
    ENST00000424881 ; ENSP00000393876 ; ENSG00000197343 . [Q8N720-3 ]
    ENST00000440391 ; ENSP00000396396 ; ENSG00000197343 . [Q8N720-4 ]
    ENST00000493277 ; ENSP00000419135 ; ENSG00000197343 . [Q8N720-3 ]
    GeneIDi 79027.
    KEGGi hsa:79027.
    UCSCi uc003urc.3. human. [Q8N720-2 ]
    uc003urh.3. human. [Q8N720-1 ]
    uc003uri.3. human.
    uc010lga.3. human. [Q8N720-3 ]

    Organism-specific databases

    CTDi 79027.
    GeneCardsi GC07P099156.
    HGNCi HGNC:30899. ZNF655.
    HPAi HPA029534.
    HPA050750.
    neXtProti NX_Q8N720.
    PharmGKBi PA134883537.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOVERGENi HBG018163.
    InParanoidi Q8N720.
    OMAi EASDKSC.
    OrthoDBi EOG79CZ0P.
    PhylomeDBi Q8N720.
    TreeFami TF344137.

    Enzyme and pathway databases

    Reactomei REACT_12627. Generic Transcription Pathway.

    Miscellaneous databases

    ChiTaRSi ZNF655. human.
    GeneWikii ZNF655.
    GenomeRNAii 79027.
    NextBioi 67721.
    PROi Q8N720.

    Gene expression databases

    ArrayExpressi Q8N720.
    Bgeei Q8N720.
    CleanExi HS_ZNF655.
    Genevestigatori Q8N720.

    Family and domain databases

    Gene3Di 3.30.160.60. 8 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF00096. zf-C2H2. 1 hit.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 7 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 6 hits.
    PS50157. ZINC_FINGER_C2H2_2. 6 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH VAV1 AND CDK4.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
      Tissue: Brain, Small intestine, Trachea and Uterus.
    3. "The DNA sequence of human chromosome 7."
      Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
      , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
      Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "Human chromosome 7: DNA sequence and biology."
      Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
      , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
      Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ASP-52.
      Tissue: Brain, Cervix, Pancreas, Placenta and Skin.
    7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiZN655_HUMAN
    AccessioniPrimary (citable) accession number: Q8N720
    Secondary accession number(s): A4D291
    , A6NGD3, B4E3M4, B7Z9Q9, D6W5T4, Q8IV00, Q8TA89, Q96EZ3, Q9BQ85
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 1, 2005
    Last sequence update: October 17, 2006
    Last modified: October 1, 2014
    This is version 110 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 7
      Human chromosome 7: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3