Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q8N720

- ZN655_HUMAN

UniProt

Q8N720 - ZN655_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc finger protein 655

Gene

ZNF655

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri212 – 23423C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri240 – 26223C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri303 – 32523C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri330 – 35324C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri380 – 40223C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri408 – 43023C2H2-type 6PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. sequence-specific DNA binding transcription factor activity Source: RefGenome

GO - Biological processi

  1. negative regulation of G1/S transition of mitotic cell cycle Source: UniProtKB
  2. regulation of transcription, DNA-templated Source: RefGenome
  3. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_12627. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 655
Alternative name(s):
Vav-interacting Krueppel-like protein
Gene namesi
Name:ZNF655
Synonyms:VIK
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 7

Organism-specific databases

HGNCiHGNC:30899. ZNF655.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. nucleolus Source: UniProtKB
  3. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134883537.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 491491Zinc finger protein 655PRO_0000047700Add
BLAST

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ8N720.
PaxDbiQ8N720.
PeptideAtlasiQ8N720.
PRIDEiQ8N720.

PTM databases

PhosphoSiteiQ8N720.

Expressioni

Gene expression databases

BgeeiQ8N720.
CleanExiHS_ZNF655.
ExpressionAtlasiQ8N720. baseline and differential.
GenevestigatoriQ8N720.

Organism-specific databases

HPAiHPA029534.
HPA050750.

Interactioni

Subunit structurei

Interacts with VAV1 and CDK4.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CDK4P118023EBI-625509,EBI-295644
VAV1P154985EBI-625509,EBI-625518

Protein-protein interaction databases

BioGridi122495. 10 interactions.
DIPiDIP-34108N.
IntActiQ8N720. 13 interactions.
MINTiMINT-1211608.
STRINGi9606.ENSP00000393876.

Structurei

3D structure databases

ProteinModelPortaliQ8N720.
SMRiQ8N720. Positions 120-489.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 6 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri212 – 23423C2H2-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri240 – 26223C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri303 – 32523C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri330 – 35324C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri380 – 40223C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri408 – 43023C2H2-type 6PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
GeneTreeiENSGT00760000119441.
HOVERGENiHBG018163.
InParanoidiQ8N720.
OMAiEASDKSC.
OrthoDBiEOG79CZ0P.
PhylomeDBiQ8N720.
TreeFamiTF344137.

Family and domain databases

Gene3Di3.30.160.60. 8 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 7 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q8N720-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEEIPAQEAA GSPRVQFQSL ETQSECLSPE PQFVQDTDME QGLTGDGETR
60 70 80 90 100
EENKLLIPKQ KISEEVHSYK VRVGRLKHDI TQVPETREVY KSEDRLERLQ
110 120 130 140 150
EILRKFLYLE REFRQITISK ETFTSEKNNE CHEPEKSFSL DSTIDADQRV
160 170 180 190 200
LRIQNTDDND KYDMSFNQNS ASGKHEHLNL TEDFQSSECK ESLMDLSHLN
210 220 230 240 250
KWESIPNTEK SYKCDVCGKI FHQSSALTRH QRIHTREKPY KCKECEKSFS
260 270 280 290 300
QSSSLSRHKR IHTREKPYKC EASDKSCEAS DKSCSPSSGI IQHKKIHTRA
310 320 330 340 350
KSYKCSSCER VFSRSVHLTQ HQKIHKEMPC KCTVCGSDFC HTSYLLEHQR
360 370 380 390 400
VHHEEKAYEY DEYGLAYIKQ QGIHFREKPY TCSECGKDFR LNSHLIQHQR
410 420 430 440 450
IHTGEKAHEC NECGKAFSQT SCLIQHHKMH RKEKSYECNE YEGSFSHSSD
460 470 480 490
LILQQEVLTR QKAFDCDVWE KNSSQRAHLV QHQSIHTKEN S
Length:491
Mass (Da):57,407
Last modified:October 17, 2006 - v3
Checksum:i04FD791D769C3A80
GO
Isoform 2 (identifier: Q8N720-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     46-181: DGETREENKL...SGKHEHLNLT → APPVPQVPAL...PCSETPFPRL
     182-491: Missing.

Note: Contains a phosphoserine at position 60.

Show »
Length:181
Mass (Da):20,005
Checksum:i5279EA5A29623353
GO
Isoform 3 (identifier: Q8N720-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     45-45: G → GGFPISKPDGISQLEQDLQVFDLETKTREVLRDDCS

Show »
Length:526
Mass (Da):61,369
Checksum:i10FD9EB53A793034
GO
Isoform 4 (identifier: Q8N720-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     46-110: DGETREENKL...EILRKFLYLE → GILLRLPTTR...PCSETPFPRL
     111-491: Missing.

Note: No experimental confirmation available.

Show »
Length:110
Mass (Da):12,037
Checksum:iF59440491AE80D7B
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti178 – 1781L → S in BAH14395. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti52 – 521E → D.1 Publication
Corresponds to variant rs17853754 [ dbSNP | Ensembl ].
VAR_028165

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei45 – 451G → GGFPISKPDGISQLEQDLQV FDLETKTREVLRDDCS in isoform 3. 1 PublicationVSP_041157
Alternative sequencei46 – 181136DGETR…HLNLT → APPVPQVPALPREGSPGDQA AALLTARYQEFVTFEDVAVH LTREEWGYLDPVQRDLYREV MLENYGNVVSLGILLRLPTT RIHSVNSCPALSHTQASAFS GETLAVLTAGISKRWPKYRL PIDIARPCSETPFPRL in isoform 2. 1 PublicationVSP_036030Add
BLAST
Alternative sequencei46 – 11065DGETR…FLYLE → GILLRLPTTRIHSVNSCPAL SHTQASAFSGETLAVLTAGI SKRWPKYRLPIDIARPCSET PFPRL in isoform 4. 1 PublicationVSP_044809Add
BLAST
Alternative sequencei111 – 491381Missing in isoform 4. 1 PublicationVSP_044810Add
BLAST
Alternative sequencei182 – 491310Missing in isoform 2. 1 PublicationVSP_036031Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY099353 mRNA. Translation: AAM33786.1.
AK027114 mRNA. No translation available.
AK304785 mRNA. Translation: BAG65536.1.
AK314593 mRNA. Translation: BAG37165.1.
AK316024 mRNA. Translation: BAH14395.1.
AC005020 Genomic DNA. Translation: AAS02017.1.
CH236956 Genomic DNA. Translation: EAL23871.1.
CH471091 Genomic DNA. Translation: EAW76650.1.
CH236956 Genomic DNA. Translation: EAL23870.1.
CH471091 Genomic DNA. Translation: EAW76651.1.
BC000823 mRNA. Translation: AAH00823.1.
BC004288 mRNA. Translation: AAH04288.1.
BC007378 mRNA. Translation: AAH07378.1.
BC011816 mRNA. Translation: AAH11816.1.
BC024770 mRNA. Translation: AAH24770.1.
BC037407 mRNA. Translation: AAH37407.1.
CCDSiCCDS34695.1. [Q8N720-4]
CCDS47655.1. [Q8N720-3]
CCDS5669.1. [Q8N720-1]
CCDS5670.1. [Q8N720-2]
RefSeqiNP_001009958.1. NM_001009958.1. [Q8N720-4]
NP_001009960.1. NM_001009960.1. [Q8N720-1]
NP_001077425.1. NM_001083956.1. [Q8N720-3]
NP_001078835.1. NM_001085366.1. [Q8N720-4]
NP_001078836.1. NM_001085367.1. [Q8N720-2]
NP_001078837.1. NM_001085368.1. [Q8N720-3]
NP_076966.1. NM_024061.3. [Q8N720-2]
NP_612503.1. NM_138494.2. [Q8N720-1]
UniGeneiHs.599798.

Genome annotation databases

EnsembliENST00000252713; ENSP00000252713; ENSG00000197343. [Q8N720-1]
ENST00000320583; ENSP00000322363; ENSG00000197343. [Q8N720-2]
ENST00000357864; ENSP00000350530; ENSG00000197343. [Q8N720-4]
ENST00000394163; ENSP00000377718; ENSG00000197343. [Q8N720-1]
ENST00000424881; ENSP00000393876; ENSG00000197343. [Q8N720-3]
ENST00000440391; ENSP00000396396; ENSG00000197343. [Q8N720-4]
ENST00000493277; ENSP00000419135; ENSG00000197343. [Q8N720-3]
GeneIDi79027.
KEGGihsa:79027.
UCSCiuc003urc.3. human. [Q8N720-2]
uc003urh.3. human. [Q8N720-1]
uc003uri.3. human.
uc010lga.3. human. [Q8N720-3]

Polymorphism databases

DMDMi116242863.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY099353 mRNA. Translation: AAM33786.1 .
AK027114 mRNA. No translation available.
AK304785 mRNA. Translation: BAG65536.1 .
AK314593 mRNA. Translation: BAG37165.1 .
AK316024 mRNA. Translation: BAH14395.1 .
AC005020 Genomic DNA. Translation: AAS02017.1 .
CH236956 Genomic DNA. Translation: EAL23871.1 .
CH471091 Genomic DNA. Translation: EAW76650.1 .
CH236956 Genomic DNA. Translation: EAL23870.1 .
CH471091 Genomic DNA. Translation: EAW76651.1 .
BC000823 mRNA. Translation: AAH00823.1 .
BC004288 mRNA. Translation: AAH04288.1 .
BC007378 mRNA. Translation: AAH07378.1 .
BC011816 mRNA. Translation: AAH11816.1 .
BC024770 mRNA. Translation: AAH24770.1 .
BC037407 mRNA. Translation: AAH37407.1 .
CCDSi CCDS34695.1. [Q8N720-4 ]
CCDS47655.1. [Q8N720-3 ]
CCDS5669.1. [Q8N720-1 ]
CCDS5670.1. [Q8N720-2 ]
RefSeqi NP_001009958.1. NM_001009958.1. [Q8N720-4 ]
NP_001009960.1. NM_001009960.1. [Q8N720-1 ]
NP_001077425.1. NM_001083956.1. [Q8N720-3 ]
NP_001078835.1. NM_001085366.1. [Q8N720-4 ]
NP_001078836.1. NM_001085367.1. [Q8N720-2 ]
NP_001078837.1. NM_001085368.1. [Q8N720-3 ]
NP_076966.1. NM_024061.3. [Q8N720-2 ]
NP_612503.1. NM_138494.2. [Q8N720-1 ]
UniGenei Hs.599798.

3D structure databases

ProteinModelPortali Q8N720.
SMRi Q8N720. Positions 120-489.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122495. 10 interactions.
DIPi DIP-34108N.
IntActi Q8N720. 13 interactions.
MINTi MINT-1211608.
STRINGi 9606.ENSP00000393876.

PTM databases

PhosphoSitei Q8N720.

Polymorphism databases

DMDMi 116242863.

Proteomic databases

MaxQBi Q8N720.
PaxDbi Q8N720.
PeptideAtlasi Q8N720.
PRIDEi Q8N720.

Protocols and materials databases

DNASUi 79027.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000252713 ; ENSP00000252713 ; ENSG00000197343 . [Q8N720-1 ]
ENST00000320583 ; ENSP00000322363 ; ENSG00000197343 . [Q8N720-2 ]
ENST00000357864 ; ENSP00000350530 ; ENSG00000197343 . [Q8N720-4 ]
ENST00000394163 ; ENSP00000377718 ; ENSG00000197343 . [Q8N720-1 ]
ENST00000424881 ; ENSP00000393876 ; ENSG00000197343 . [Q8N720-3 ]
ENST00000440391 ; ENSP00000396396 ; ENSG00000197343 . [Q8N720-4 ]
ENST00000493277 ; ENSP00000419135 ; ENSG00000197343 . [Q8N720-3 ]
GeneIDi 79027.
KEGGi hsa:79027.
UCSCi uc003urc.3. human. [Q8N720-2 ]
uc003urh.3. human. [Q8N720-1 ]
uc003uri.3. human.
uc010lga.3. human. [Q8N720-3 ]

Organism-specific databases

CTDi 79027.
GeneCardsi GC07P099156.
HGNCi HGNC:30899. ZNF655.
HPAi HPA029534.
HPA050750.
neXtProti NX_Q8N720.
PharmGKBi PA134883537.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
GeneTreei ENSGT00760000119441.
HOVERGENi HBG018163.
InParanoidi Q8N720.
OMAi EASDKSC.
OrthoDBi EOG79CZ0P.
PhylomeDBi Q8N720.
TreeFami TF344137.

Enzyme and pathway databases

Reactomei REACT_12627. Generic Transcription Pathway.

Miscellaneous databases

ChiTaRSi ZNF655. human.
GeneWikii ZNF655.
GenomeRNAii 79027.
NextBioi 67721.
PROi Q8N720.

Gene expression databases

Bgeei Q8N720.
CleanExi HS_ZNF655.
ExpressionAtlasi Q8N720. baseline and differential.
Genevestigatori Q8N720.

Family and domain databases

Gene3Di 3.30.160.60. 8 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF00096. zf-C2H2. 1 hit.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 7 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH VAV1 AND CDK4.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
    Tissue: Brain, Small intestine, Trachea and Uterus.
  3. "The DNA sequence of human chromosome 7."
    Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L.
    , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
    Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ASP-52.
    Tissue: Brain, Cervix, Pancreas, Placenta and Skin.
  7. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiZN655_HUMAN
AccessioniPrimary (citable) accession number: Q8N720
Secondary accession number(s): A4D291
, A6NGD3, B4E3M4, B7Z9Q9, D6W5T4, Q8IV00, Q8TA89, Q96EZ3, Q9BQ85
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: October 17, 2006
Last modified: October 29, 2014
This is version 111 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3