Q8N720 (ZN655_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger protein 655 Alternative name(s): Vav-interacting Krueppel-like protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 491 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be involved in transcriptional regulation. |
| Subunit structure | Interacts with VAV1 and CDK4. Ref.1 |
| Subcellular location | Nucleus Probable. |
| Sequence similarities | Belongs to the krueppel C2H2-type zinc-finger protein family. Contains 6 C2H2-type zinc fingers. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | negative regulation of G1/S transition of mitotic cell cycle Inferred from direct assay Ref.1. Source: UniProtKB regulation of transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytoplasm Inferred from direct assay Ref.1. Source: UniProtKB nucleolusInferred from direct assay Ref.1. Source: UniProtKB |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CDK4 | P11802 | 3 | EBI-625509,EBI-295644 | |
| VAV1 | P15498 | 5 | EBI-625509,EBI-625518 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q8N720-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q8N720-2) The sequence of this isoform differs from the canonical sequence as follows: 46-181: DGETREENKL...SGKHEHLNLT → APPVPQVPAL...PCSETPFPRL 182-491: Missing. | ||||||
| Note: Contains a phosphoserine at position 60. | ||||||
| Isoform 3 (identifier: Q8N720-3) The sequence of this isoform differs from the canonical sequence as follows: 45-45: G → GGFPISKPDGISQLEQDLQVFDLETKTREVLRDDCS | ||||||
| Isoform 4 (identifier: Q8N720-4) The sequence of this isoform differs from the canonical sequence as follows: 46-110: DGETREENKL...EILRKFLYLE → GILLRLPTTR...PCSETPFPRL 111-491: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 491 | 491 | Zinc finger protein 655 | PRO_0000047700 | |||||
Regions | |||||||||
| Zinc finger | 212 – 234 | 23 | C2H2-type 1 | ||||||
| Zinc finger | 240 – 262 | 23 | C2H2-type 2 | ||||||
| Zinc finger | 303 – 325 | 23 | C2H2-type 3 | ||||||
| Zinc finger | 330 – 353 | 24 | C2H2-type 4 | ||||||
| Zinc finger | 380 – 402 | 23 | C2H2-type 5 | ||||||
| Zinc finger | 408 – 430 | 23 | C2H2-type 6 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1 | 1 | N-acetylmethionine Ref.9 | ||||||
| Modified residue | 12 | 1 | Phosphoserine Ref.7 Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 45 | 1 | G → GGFPISKPDGISQLEQDLQV FDLETKTREVLRDDCS in isoform 3. | VSP_041157 | |||||
| Alternative sequence | 46 – 181 | 136 | DGETR…HLNLT → APPVPQVPALPREGSPGDQA AALLTARYQEFVTFEDVAVH LTREEWGYLDPVQRDLYREV MLENYGNVVSLGILLRLPTT RIHSVNSCPALSHTQASAFS GETLAVLTAGISKRWPKYRL PIDIARPCSETPFPRL in isoform 2. | VSP_036030 | |||||
| Alternative sequence | 46 – 110 | 65 | DGETR…FLYLE → GILLRLPTTRIHSVNSCPAL SHTQASAFSGETLAVLTAGI SKRWPKYRLPIDIARPCSET PFPRL in isoform 4. | VSP_044809 | |||||
| Alternative sequence | 111 – 491 | 381 | Missing in isoform 4. | VSP_044810 | |||||
| Alternative sequence | 182 – 491 | 310 | Missing in isoform 2. | VSP_036031 | |||||
| Natural variant | 52 | 1 | E → D. Ref.6 Corresponds to variant rs17853754 [ dbSNP | Ensembl ]. | VAR_028165 | |||||
Experimental info | |||||||||
| Sequence conflict | 178 | 1 | L → S in BAH14395. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Characterization of VIK-1: a new Vav-interacting Kruppel-like protein." Houlard M., Romero-Portillo F., Germani A., Depaux A., Regnier-Ricard F., Gisselbrecht S., Varin-Blank N. Oncogene 24:28-38(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH VAV1 AND CDK4. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4). Tissue: Brain, Small intestine, Trachea and Uterus. |
| [3] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Human chromosome 7: DNA sequence and biology." Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. Tsui L.-C.Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ASP-52. Tissue: Brain, Cervix, Pancreas, Placenta and Skin. |
| [7] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY099353 mRNA. Translation: AAM33786.1. AK027114 mRNA. No translation available. AK304785 mRNA. Translation: BAG65536.1. AK314593 mRNA. Translation: BAG37165.1. AK316024 mRNA. Translation: BAH14395.1. AC005020 Genomic DNA. Translation: AAS02017.1. CH236956 Genomic DNA. Translation: EAL23871.1. CH471091 Genomic DNA. Translation: EAW76650.1. CH236956 Genomic DNA. Translation: EAL23870.1. CH471091 Genomic DNA. Translation: EAW76651.1. BC000823 mRNA. Translation: AAH00823.1. BC004288 mRNA. Translation: AAH04288.1. BC007378 mRNA. Translation: AAH07378.1. BC011816 mRNA. Translation: AAH11816.1. BC024770 mRNA. Translation: AAH24770.1. BC037407 mRNA. Translation: AAH37407.1. |
| IPI | IPI00031606. IPI00292660. IPI00552130. IPI00925360. |
| RefSeq | NP_001009958.1. NM_001009958.1. NP_001009960.1. NM_001009960.1. NP_001077425.1. NM_001083956.1. NP_001078835.1. NM_001085366.1. NP_001078836.1. NM_001085367.1. NP_001078837.1. NM_001085368.1. NP_076966.1. NM_024061.3. NP_612503.1. NM_138494.2. |
| UniGene | Hs.599798. |
3D structure databases | |
| ProteinModelPortal | Q8N720. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-34108N. |
| IntAct | Q8N720. 12 interactions. |
| MINT | MINT-1211608. |
| STRING | 9606.ENSP00000393876. |
PTM databases | |
| PhosphoSite | Q8N720. |
Polymorphism databases | |
| DMDM | 116242863. |
Proteomic databases | |
| PaxDb | Q8N720. |
| PeptideAtlas | Q8N720. |
| PRIDE | Q8N720. |
Protocols and materials databases | |
| DNASU | 79027. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000252713; ENSP00000252713; ENSG00000197343. ENST00000320583; ENSP00000322363; ENSG00000197343. ENST00000357864; ENSP00000350530; ENSG00000197343. ENST00000394163; ENSP00000377718; ENSG00000197343. ENST00000424881; ENSP00000393876; ENSG00000197343. ENST00000440391; ENSP00000396396; ENSG00000197343. ENST00000493277; ENSP00000419135; ENSG00000197343. |
| GeneID | 79027. |
| KEGG | hsa:79027. |
| UCSC | uc003urc.3. human. uc003urh.3. human. uc010lga.3. human. |
Organism-specific databases | |
| CTD | 79027. |
| GeneCards | GC07P099156. |
| HGNC | HGNC:30899. ZNF655. |
| HPA | HPA029534. |
| neXtProt | NX_Q8N720. |
| PharmGKB | PA134883537. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5048. |
| HOVERGEN | HBG018163. |
| InParanoid | Q8N720. |
| OMA | TFTSEKN. |
| OrthoDB | EOG4SBF01. |
| PhylomeDB | Q8N720. |
Enzyme and pathway databases | |
| Reactome | REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | Q8N720. |
| Bgee | Q8N720. |
| CleanEx | HS_ZNF655. |
| Genevestigator | Q8N720. |
| GermOnline | ENSG00000197343. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.160.60. 8 hits. |
| InterPro | IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| Pfam | PF00096. zf-C2H2. 1 hit. [Graphical view] |
| SMART | SM00355. ZnF_C2H2. 7 hits. [Graphical view] |
| PROSITE | PS00028. ZINC_FINGER_C2H2_1. 6 hits. PS50157. ZINC_FINGER_C2H2_2. 6 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | ZNF655. human. |
| GenomeRNAi | 79027. |
| NextBio | 67721. |
Entry information
| Entry name | ZN655_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q8N720 Secondary accession number(s): A4D291 Q9BQ85 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
