Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q8N720 (ZN655_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc finger protein 655
Alternative name(s):
Vav-interacting Krueppel-like protein
Gene names
Name:ZNF655
Synonyms:VIK
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length491 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

May be involved in transcriptional regulation.

Subunit structure

Interacts with VAV1 and CDK4. Ref.1

Subcellular location

Nucleus Probable.

Sequence similarities

Belongs to the krueppel C2H2-type zinc-finger protein family.

Contains 6 C2H2-type zinc fingers.

Binary interactions

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q8N720-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q8N720-2)

The sequence of this isoform differs from the canonical sequence as follows:
     46-181: DGETREENKL...SGKHEHLNLT → APPVPQVPAL...PCSETPFPRL
     182-491: Missing.
Note: Contains a phosphoserine at position 60.
Isoform 3 (identifier: Q8N720-3)

The sequence of this isoform differs from the canonical sequence as follows:
     45-45: G → GGFPISKPDGISQLEQDLQVFDLETKTREVLRDDCS
Isoform 4 (identifier: Q8N720-4)

The sequence of this isoform differs from the canonical sequence as follows:
     46-110: DGETREENKL...EILRKFLYLE → GILLRLPTTR...PCSETPFPRL
     111-491: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 491491Zinc finger protein 655
PRO_0000047700

Regions

Zinc finger212 – 23423C2H2-type 1
Zinc finger240 – 26223C2H2-type 2
Zinc finger303 – 32523C2H2-type 3
Zinc finger330 – 35324C2H2-type 4
Zinc finger380 – 40223C2H2-type 5
Zinc finger408 – 43023C2H2-type 6

Natural variations

Alternative sequence451G → GGFPISKPDGISQLEQDLQV FDLETKTREVLRDDCS in isoform 3.
VSP_041157
Alternative sequence46 – 181136DGETR…HLNLT → APPVPQVPALPREGSPGDQA AALLTARYQEFVTFEDVAVH LTREEWGYLDPVQRDLYREV MLENYGNVVSLGILLRLPTT RIHSVNSCPALSHTQASAFS GETLAVLTAGISKRWPKYRL PIDIARPCSETPFPRL in isoform 2.
VSP_036030
Alternative sequence46 – 11065DGETR…FLYLE → GILLRLPTTRIHSVNSCPAL SHTQASAFSGETLAVLTAGI SKRWPKYRLPIDIARPCSET PFPRL in isoform 4.
VSP_044809
Alternative sequence111 – 491381Missing in isoform 4.
VSP_044810
Alternative sequence182 – 491310Missing in isoform 2.
VSP_036031
Natural variant521E → D. Ref.6
Corresponds to variant rs17853754 [ dbSNP | Ensembl ].
VAR_028165

Experimental info

Sequence conflict1781L → S in BAH14395. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 17, 2006. Version 3.
Checksum: 04FD791D769C3A80

FASTA49157,407
        10         20         30         40         50         60 
MEEIPAQEAA GSPRVQFQSL ETQSECLSPE PQFVQDTDME QGLTGDGETR EENKLLIPKQ 

        70         80         90        100        110        120 
KISEEVHSYK VRVGRLKHDI TQVPETREVY KSEDRLERLQ EILRKFLYLE REFRQITISK 

       130        140        150        160        170        180 
ETFTSEKNNE CHEPEKSFSL DSTIDADQRV LRIQNTDDND KYDMSFNQNS ASGKHEHLNL 

       190        200        210        220        230        240 
TEDFQSSECK ESLMDLSHLN KWESIPNTEK SYKCDVCGKI FHQSSALTRH QRIHTREKPY 

       250        260        270        280        290        300 
KCKECEKSFS QSSSLSRHKR IHTREKPYKC EASDKSCEAS DKSCSPSSGI IQHKKIHTRA 

       310        320        330        340        350        360 
KSYKCSSCER VFSRSVHLTQ HQKIHKEMPC KCTVCGSDFC HTSYLLEHQR VHHEEKAYEY 

       370        380        390        400        410        420 
DEYGLAYIKQ QGIHFREKPY TCSECGKDFR LNSHLIQHQR IHTGEKAHEC NECGKAFSQT 

       430        440        450        460        470        480 
SCLIQHHKMH RKEKSYECNE YEGSFSHSSD LILQQEVLTR QKAFDCDVWE KNSSQRAHLV 

       490 
QHQSIHTKEN S 

« Hide

Isoform 2 [UniParc].

Checksum: 5279EA5A29623353
Show »

FASTA18120,005
Isoform 3 [UniParc].

Checksum: 10FD9EB53A793034
Show »

FASTA52661,369
Isoform 4 [UniParc].

Checksum: F59440491AE80D7B
Show »

FASTA11012,037

References

« Hide 'large scale' references
[1]"Characterization of VIK-1: a new Vav-interacting Kruppel-like protein."
Houlard M., Romero-Portillo F., Germani A., Depaux A., Regnier-Ricard F., Gisselbrecht S., Varin-Blank N.
Oncogene 24:28-38(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH VAV1 AND CDK4.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4).
Tissue: Brain, Small intestine, Trachea and Uterus.
[3]"The DNA sequence of human chromosome 7."
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. expand/collapse author list , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.
Nature 424:157-164(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"Human chromosome 7: DNA sequence and biology."
Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S. expand/collapse author list , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ASP-52.
Tissue: Brain, Cervix, Pancreas, Placenta and Skin.
[7]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-60 (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY099353 mRNA. Translation: AAM33786.1.
AK027114 mRNA. No translation available.
AK304785 mRNA. Translation: BAG65536.1.
AK314593 mRNA. Translation: BAG37165.1.
AK316024 mRNA. Translation: BAH14395.1.
AC005020 Genomic DNA. Translation: AAS02017.1.
CH236956 Genomic DNA. Translation: EAL23871.1.
CH471091 Genomic DNA. Translation: EAW76650.1.
CH236956 Genomic DNA. Translation: EAL23870.1.
CH471091 Genomic DNA. Translation: EAW76651.1.
BC000823 mRNA. Translation: AAH00823.1.
BC004288 mRNA. Translation: AAH04288.1.
BC007378 mRNA. Translation: AAH07378.1.
BC011816 mRNA. Translation: AAH11816.1.
BC024770 mRNA. Translation: AAH24770.1.
BC037407 mRNA. Translation: AAH37407.1.
RefSeqNP_001009958.1. NM_001009958.1.
NP_001009960.1. NM_001009960.1.
NP_001077425.1. NM_001083956.1.
NP_001078835.1. NM_001085366.1.
NP_001078836.1. NM_001085367.1.
NP_001078837.1. NM_001085368.1.
NP_076966.1. NM_024061.3.
NP_612503.1. NM_138494.2.
UniGeneHs.599798.

3D structure databases

ProteinModelPortalQ8N720.
SMRQ8N720. Positions 120-489.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122495. 8 interactions.
DIPDIP-34108N.
IntActQ8N720. 12 interactions.
MINTMINT-1211608.
STRING9606.ENSP00000393876.

PTM databases

PhosphoSiteQ8N720.

Polymorphism databases

DMDM116242863.

Proteomic databases

PaxDbQ8N720.
PeptideAtlasQ8N720.
PRIDEQ8N720.

Protocols and materials databases

DNASU79027.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000252713; ENSP00000252713; ENSG00000197343. [Q8N720-1]
ENST00000320583; ENSP00000322363; ENSG00000197343. [Q8N720-2]
ENST00000357864; ENSP00000350530; ENSG00000197343. [Q8N720-4]
ENST00000394163; ENSP00000377718; ENSG00000197343. [Q8N720-1]
ENST00000424881; ENSP00000393876; ENSG00000197343. [Q8N720-3]
ENST00000440391; ENSP00000396396; ENSG00000197343. [Q8N720-4]
ENST00000493277; ENSP00000419135; ENSG00000197343. [Q8N720-3]
GeneID79027.
KEGGhsa:79027.
UCSCuc003urc.3. human. [Q8N720-2]
uc003urh.3. human. [Q8N720-1]
uc003uri.3. human.
uc010lga.3. human. [Q8N720-3]

Organism-specific databases

CTD79027.
GeneCardsGC07P099156.
HGNCHGNC:30899. ZNF655.
HPAHPA029534.
HPA050750.
neXtProtNX_Q8N720.
PharmGKBPA134883537.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5048.
HOVERGENHBG018163.
InParanoidQ8N720.
OMAEASDKSC.
OrthoDBEOG79CZ0P.
PhylomeDBQ8N720.
TreeFamTF344137.

Enzyme and pathway databases

ReactomeREACT_71. Gene Expression.

Gene expression databases

ArrayExpressQ8N720.
BgeeQ8N720.
CleanExHS_ZNF655.
GenevestigatorQ8N720.

Family and domain databases

Gene3D3.30.160.60. 8 hits.
InterProIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamPF00096. zf-C2H2. 1 hit.
[Graphical view]
SMARTSM00355. ZnF_C2H2. 7 hits.
[Graphical view]
PROSITEPS00028. ZINC_FINGER_C2H2_1. 6 hits.
PS50157. ZINC_FINGER_C2H2_2. 6 hits.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSZNF655. human.
GeneWikiZNF655.
GenomeRNAi79027.
NextBio67721.
PROQ8N720.

Entry information

Entry nameZN655_HUMAN
AccessionPrimary (citable) accession number: Q8N720
Secondary accession number(s): A4D291 expand/collapse secondary AC list , A6NGD3, B4E3M4, B7Z9Q9, D6W5T4, Q8IV00, Q8TA89, Q96EZ3, Q9BQ85
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 2005
Last sequence update: October 17, 2006
Last modified: April 16, 2014
This is version 105 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 7

Human chromosome 7: entries, gene names and cross-references to MIM